GPR84

DescriçãoG-protein coupled receptor 84

Gene and Protein Information

Gene ID53831
Uniprot Accession IDs Q9NQS5 B6V9G7
Ensembl ID ENSP00000450310
Symbol EX33 EX33 GPCR4
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp467012GPR84G protein-coupled receptor 849598VGNC:8600OMA, EggNOG
Macaque705309GPR84G protein-coupled receptor 849544Inparanoid, OMA, EggNOG
Mouse80910Gpr84G protein-coupled receptor 8410090MGI:1934129Inparanoid, OMA, EggNOG
Rat688730Gpr84G protein-coupled receptor 8410116RGD:1585277Inparanoid, OMA, EggNOG
Dog100687941GPR84G protein-coupled receptor 849615VGNC:41446Inparanoid, OMA, EggNOG
Horse100062469GPR84G protein-coupled receptor 849796VGNC:18550Inparanoid, OMA, EggNOG
Cow540044GPR84G protein-coupled receptor 849913VGNC:29601Inparanoid, OMA, EggNOG
Platypus100084002GPR84G protein-coupled receptor 849258Inparanoid, OMA, EggNOG
Anole lizard100567961gpr84G protein-coupled receptor 8428377Inparanoid, OMA, EggNOG
Xenopus779788gpr84G protein-coupled receptor 848364XB-GENE-491098Inparanoid, OMA, EggNOG
Zebrafish100126017gpr84G protein-coupled receptor 847955ZDB-GENE-070928-33Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 84
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Galanin like    /    G-protein coupled receptor 84

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.