TCL1A

DescriçãoT-cell leukemia/lymphoma protein 1A

Gene and Protein Information

Gene ID8115
Uniprot Accession IDs P56279 Q6IBK7
Ensembl ID ENSP00000385036
Symbol TCL1 TCL1
FamilyBelongs to the TCL1 family.
Sequence
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp741380TCL1AT-cell leukemia/lymphoma 1A9598OMA, EggNOG
MacaqueTCL1AT cell leukemia/lymphoma 1A [Source:HGNC Symbol;Acc:HGNC:11648]9544Inparanoid, OMA
Mouse21432Tcl1T cell lymphoma breakpoint 110090MGI:1097166Inparanoid, OMA, EggNOG
Rat690575Tcl1aT-cell leukemia/lymphoma 1A10116RGD:1594686Inparanoid, OMA, EggNOG
Cow506540TCL1AT-cell leukemia/lymphoma 1A9913Inparanoid, OMA, EggNOG
Pig100156364TCL1AT-cell leukemia/lymphoma 1A9823OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.