🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS CoA Structure
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

TCL1A

DescriçãoT-cell leukemia/lymphoma protein 1A

Gene and Protein Information

Gene ID8115
Uniprot Accession IDs P56279 Q6IBK7
Ensembl ID ENSP00000385036
Symbol TCL1 TCL1
FamilyBelongs to the TCL1 family.
Sequence
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp741380TCL1AT-cell leukemia/lymphoma 1A9598OMA, EggNOG
MacaqueTCL1AT cell leukemia/lymphoma 1A [Source:HGNC Symbol;Acc:HGNC:11648]9544Inparanoid, OMA
Mouse21432Tcl1T cell lymphoma breakpoint 110090MGI:1097166Inparanoid, OMA, EggNOG
Rat690575Tcl1aT-cell leukemia/lymphoma 1A10116RGD:1594686Inparanoid, OMA, EggNOG
Cow506540TCL1AT-cell leukemia/lymphoma 1A9913Inparanoid, OMA, EggNOG
Pig100156364TCL1AT-cell leukemia/lymphoma 1A9823OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.