🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

ELOVL3

DescriçãoElongation of very long chain fatty acids protein 3

Gene and Protein Information

Gene ID83401
Uniprot Accession IDs Q9HB03 Q5VZL3 Q8N180
Ensembl ID ENSP00000359022
Symbol CIG30 CIG30 CIG-30
FamilyBelongs to the ELO family. ELOVL3 subfamily.
Sequence
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp745450ELOVL3ELOVL fatty acid elongase 39598VGNC:7275OMA, EggNOG
Macaque712927ELOVL3ELOVL fatty acid elongase 39544Inparanoid, OMA, EggNOG
Mouse12686Elovl3elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 310090MGI:1195976Inparanoid, OMA, EggNOG
Rat309449Elovl3ELOVL fatty acid elongase 310116RGD:1307263Inparanoid, OMA, EggNOG
Dog486855ELOVL3ELOVL fatty acid elongase 39615VGNC:40321Inparanoid, OMA, EggNOG
Horse100060081ELOVL3ELOVL fatty acid elongase 39796VGNC:17539Inparanoid, OMA, EggNOG
Cow539782ELOVL3ELOVL fatty acid elongase 39913VGNC:28449Inparanoid, OMA, EggNOG
Pig100155434ELOVL3ELOVL fatty acid elongase 39823Inparanoid, OMA, EggNOG
Opossum100029282ELOVL3ELOVL fatty acid elongase 313616Inparanoid, EggNOG
Platypus100080155ELOVL3ELOVL fatty acid elongase 39258Inparanoid, OMA, EggNOG
C. elegans183948elo-3Putative fatty acid elongation protein 36239Inparanoid, OMA
S.cerevisiae853243ELO1fatty acid elongase ELO14932S000003732Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Elongation of very long chain fatty acids protein 3
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Elongation of very long chain fatty acids protein 3

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.