Alternar navegação 
Pesquisar
340,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque
| Descrição | Tryptase gamma |
|---|
Gene and Protein Information
| Gene ID | 25823 |
|---|---|
| Uniprot Accession IDs | Q9NRR2 Q96RZ8 Q9C015 Q9NRQ8 Q9UBB2 |
| Ensembl ID | ENSP00000234798 |
| Symbol | PRSS31 TMT TMT trpA PRSS31 |
| Family | Belongs to the peptidase S1 family. Tryptase subfamily. |
| Sequence | MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Número de identificação fiscal | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 100425751 | TPSG1 | tryptase gamma 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26945 | Tpsg1 | tryptase gamma 1 | 10090 | MGI:1349391 | Inparanoid, OMA, EggNOG |
| Rat | 302990 | Tpsg1 | tryptase gamma 1 | 10116 | RGD:631355 | Inparanoid, OMA, EggNOG |
| Horse | 100067538 | TPSG1 | tryptase gamma 1 | 9796 | VGNC:24447 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / peptide hormone / Tryptase gamma
protein / calcium-binding protein / serine protease / Tryptase gamma
protein / calcium-binding protein / protease inhibitor / Tryptase gamma
protein / calcium-binding protein / calmodulin / Tryptase gamma
protein / calcium-binding protein / annexin / Tryptase gamma
protein / calcium-binding protein / receptor / Tryptase gamma
protein / calcium-binding protein / peptide hormone / Tryptase gamma
protein / calcium-binding protein / serine protease / Tryptase gamma
protein / calcium-binding protein / protease inhibitor / Tryptase gamma
protein / calcium-binding protein / calmodulin / Tryptase gamma
protein / calcium-binding protein / annexin / Tryptase gamma
protein / calcium-binding protein / receptor / Tryptase gamma
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilidade | Ver Detalhes |
|---|
Associated Antibodies
| Nome | Specifications | Species reactivity | Aplicação | Disponibilidade | Ver Detalhes |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Lembrar-me mais tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.