🌎 Ship to: United States
Alternar Nav
Cart
Pesquisa
Envio no mesmo dia para todos os itens em stock.
Pesquisa Avançada
Encomenda rápida SDS / CoA Structure Bulk & Personalizado
Menu
Conta
Definições
྾
224,000+ produtos de pesquisa · Triple ISO certified · COA & SDS Disponível para todos os produtos · Envio no mesmo dia em itens em estoque

EPGN

DescriçãoEpigen

Gene and Protein Information

Gene ID255324
Uniprot Accession IDs Q6UW88 A1BMM3 A1BMM4 A1BMM5 A1BMM6 A1BMM7 A1BMM8 A8K090
Ensembl ID ENSP00000411898
Symbol EPG PRO9904 ALGV3072
Sequence
MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeNúmero de identificação fiscalOther Gene IDSources
Chimp461252EPGNepithelial mitogen9598VGNC:2034OMA, EggNOG
Macaque702632EPGNepithelial mitogen9544Inparanoid, OMA, EggNOG
Mouse71920Epgnepithelial mitogen10090MGI:1919170Inparanoid, OMA, EggNOG
RatAC108576.1-10116OMA, EggNOG
Dog611937EPGNepithelial mitogen9615VGNC:40403Inparanoid, OMA, EggNOG
Horse100050376EPGNepithelial mitogen9796VGNC:51183Inparanoid, OMA, EggNOG
Cow100295331EPGNepithelial mitogen9913VGNC:53711OMA, EggNOG
Opossum100023880EPGNepithelial mitogen13616Inparanoid, OMA, EggNOG
PlatypusEPGNepithelial mitogen [Source:HGNC Symbol;Acc:HGNC:17470]9258OMA, EggNOG
Chicken497270EPGNepithelial mitogen9031CGNC:8250Inparanoid, OMA, EggNOG
Anole lizardEPGNepithelial mitogen [Source:HGNC Symbol;Acc:HGNC:17470]28377Inparanoid, OMA, EggNOG
Xenopus100216288epgnepithelial mitogen8364XB-GENE-975143Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Epigen
DTO Classes
protein    /    Signaling    /    Growth factor    /    Epigen

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilidadeVer Detalhes

Associated Antibodies

NomeSpecificationsSpecies reactivityAplicaçãoDisponibilidadeVer Detalhes

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.