Determine the necessary mass, volume, or concentration for preparing a solution.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
Why this grade
for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
Apelin-36 (rat, mouse), CAS No.230299-95-3
Mecanismos bioquímicos y fisiológicos
Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50= 5.4 nM) and potently inhibits cAMP productionin vitro(EC50= 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and
Secuencia
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Tipo de acción
INHIBITOR
CAS
230299-95-3
Tipo de molécula
Small molecule
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Desiccated
Enviado en
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas
Reseñas de cliente
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.