Bay 55-9837 TFA , Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor, CAS No.463930-25-8, Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor

CAS: 463930-25-8 Cat. No.: B288002 Peso molecular: 3742.29(free basis) PubChem CID: 72941824
Disponible para pedir
GRADE & PURITY Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools. ≥98%
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
1mg
B288002-1mg
3
539,90US$
5mg
B288002-5mg
2
1.599,90US$
10mg
B288002-10mg
1
2.559,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Moligand™, ≥98% Moligand™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes.

Specifications

Product Name
Bay 55-9837 TFA , Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor, CAS No.463930-25-8
Sinónimos
UNII-SQD60KZ8RJ | His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser-ile-lys-asp-lys-arg-tyr-NH2 | BAY-55-9837 | AKOS024457254 | SQD60KZ8RJ | PD079349
Grado
Moligand™
Especificaciones y pureza
Moligand™, ≥98%
Mecanismos bioquímicos y fisiológicos
Selective VPAC2receptor agonist (EC50values are 0.4, 100 and >1000 nM for VPAC2, VPAC1and PAC1, respectively in a cAMP accumulation assay; IC50values are 60, 8700 and >10000 nM for VPAC2, VPAC1and PAC1, respectively in a competition binding assay). Stimul
Secuencia
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY(Modifications: Tyr-31 = C-terminal amide)
Tipo de acción
AGONIST
Mecanismo de acción
Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor
CAS
463930-25-8
Tipo de molécula
Small molecule
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Objetivos asociados (humanos)
VIPR2 Tchem Vasoactive intestinal polypeptide receptor 2 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
VIPR1 Tchem Vasoactive intestinal polypeptide receptor 1 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
ADCYAP1R1 Tchem Pituitary adenylate cyclase-activating polypeptide type I receptor (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
C2408276Certificate of AnalysisJan 23, 2024 B288002
C2408277Certificate of AnalysisJan 23, 2024 B288002
C2408278Certificate of AnalysisJan 23, 2024 B288002
C2408279Certificate of AnalysisJan 23, 2024 B288002
C2408286Certificate of AnalysisJan 23, 2024 B288002
C2408287Certificate of AnalysisJan 23, 2024 B288002
Información genética
Alternate NamesUNII-SQD60KZ8RJ | His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser-ile-lys-asp-lys-arg-tyr-NH2 | BAY-55-9837 | AKOS024457254 | SQD60KZ8RJ | PD079349
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.