J2522332Determine the necessary mass, volume, or concentration for preparing a solution.
Calcitonin TFA salts, Calcitonin receptor agonist, CAS No.21215-62-3(free basis), Calcitonin receptor agonist
Disponible para pedir
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
Why this grade
Moligand™, ≥95% Moligand™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 2 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Descripción general
Calcitonin is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research.
Specifications
Product Name
Calcitonin TFA salts, Calcitonin receptor agonist, CAS No.21215-62-3(free basis)
Sinónimos
Calcitonin human | CHEMBL4594248 | Forcaltonin, Fortical | CGNLSTCMLGTYTQDFN-K*-FHTFPQTAIGVGAP-NH2 [K*(13C, 15N)] | Miacalcic | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP | Heavy calcitonin peptide | calcitonin (human synthetic) | CHEBI:135973 | Calcitonin (human) t
Grado
Moligand™
Especificaciones y pureza
Moligand™, ≥95%
Secuencia
Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7)
Tipo de acción
AGONIST
Mecanismo de acción
Calcitonin receptor agonist
CAS
21215-62-3(free basis)
Tipo de molécula
Peptide
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Citations of This Product
Referencias
| 1. Zhimeng Gao, Haibo Wang, Yanjun Zuo, Ling Yuan, Xingqi Huang, Zhengwenda Liang, Wenjun Dong, Lingce Kong, Huanyu Zhao. (2024) Re-engineering and regulating molecular architecture of synthetic capsaicin for enhanced water-based degradation performance. JOURNAL OF MOLECULAR LIQUIDS, [PMID:] [10.1016/j.molliq.2024.124275] |
| 2. Yuchun Zhang, Lin Liu, Yu Qiao, Tian Yao, Xing Zhao, Yong Yan. (2025) Confinement of ions within graphene oxide membranes enables neuromorphic artificial gustation. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, 122 (28): (e2413060122). [PMID:40623193] [10.1073/pnas.2413060122] |
Calculadoras de soluciones
Reseñas
Reseñas de cliente
Need help choosing the grade?
Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.
View Moligand™ grade guide →Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.