Creatinine amidohydrolase (CAH), CAS No.9025-13-2

CAS: 9025-13-2 Cat. No.: rp216173 Peso molecular: 29 kDa
Disponible para pedir
GRADE & PURITY BioReagent ? BioReagent grade — tested suitable for life-science and molecular-biology use. Use for cell culture, assays, and biochemical work needing biological compatibility. EnzymoPure™ ? EnzymoPure™ — Aladdin's line of high-quality enzymatic solutions. Use when enzyme purity and defined activity drive assay or process performance. ≥90%(SDS-PAGE) ≥ 400 U/mg
Protein Tag
No tag
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
1KU
rp216173-1KU
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
159,90US$
10KU
rp216173-10KU
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

BioReagent, EnzymoPure™, ≥90%(SDS-PAGE), ≥ 400 U/mg BioReagent,EnzymoPure™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 1 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Hydrolyzed creatinine, used in the development and bulk formulation of enzymatic creatinine reagents.
Enzymatic properties
Source: Microorganism
Enzyme Committee No. : EC 3.5.2.10
Molecular weight: 29 kDa (SDS-PAGE)
Isoelectric point: 5.3
Km value: 5.0× 10-2 M (Creatinine),
8.0× 10-2 M (Creatine)
Inhibitors: Hg2+, Cu2+, Fe3+
Optimal pH: 7.0-8.0     Figure 1

Optimum temperature: 65℃   Figure 2
pH stability: pH 5.5-10.0 (25℃, 16 h)   Figure 3
Thermal stability: stable below 65℃ (pH 8.0, 30 min)   Figure 4
Stability: -25 ~ -15℃ standing storage
Maintain over 90% activity for 12 months    Figure 5

Assay method for activity
1. Principle 

2. Definition of enzyme activity
Unit enzyme activity is defined as the amount of enzyme required to catalyze a reaction to produce 1μmol creatine per minute under the following conditions.
3. Reagent preparation
Reagent I: 0.3M potassium phosphate buffer, pH 6.5.
Reagent II: 0.1M creatinine solution (1.13g creatinine dissolved in 100mL UP water).
Reagent III: 4% Na2CO3 solution (4.0g Na2CO3 dissolved in 100mL UP water).
Reagent IV: 2% alpha-naphthol solution (2.0g alpha-naphthol dissolved in 100 mL of 99.5% ethanol).
Reagent V: 1.2g NaOH and 3.2g Na2CO3 were dissolved in double steaming water at a constant volume of 100 mL.
Reagent VI: 0.05% diacetyl solution (0.05mL diacetyl with water to 100 mL).
Enzyme diluent: 5 mM Tris-HCl pH 8.0
4. Operation procedure
4.1. Add 0.1 mL reagent I and 0.8mL reagent II into a 5 mL centrifuge tube.
4.2. Water bath at 37℃ for 5 minutes.
4.3. Add 0.1 mL of the sample to be tested and incubate at 37℃ for 10 minutes.

4.4. Add 2.0mL reagent III to terminate the reaction, remove and place on ice.
4.5. Add the following reagents in the new 5 mL centrifuge tube in order:
The solution for step 4: 80 μL
Double steaming water: 720 μL
Reagent IV: 400 μL
Reagent V: 400 μL
Reagent VI: 400 μL
4.6. After standing at 25℃ for 1 h, add 2 mL of double steaming water to dilute.
4.7. Use a spectrophotometer to measure the absorbance at 525 nm.
* Replace enzyme liquid with enzyme diluent, other steps are the same, the absorbance of the resulting solution is blank absorbance (∆Ab)
∆A=∆As- ∆Ab


5. Vitality computing


Vt: Total volume of reaction liquid (1.0mL);
Vs: Enzyme liquid volume (0.1mL);
t: Reaction time (10 minutes);
df: Dilution ratio;
C: Enzyme concentration (mg/mL);
1.0: Optical path length (cm);
0.0704: Millimolar absorption coefficient (cm²/μmol) of chromophore at 525nm under standard reaction conditions.

Specifications

Product Name
Creatinine amidohydrolase (CAH), CAS No.9025-13-2
Sinónimos
Creatinine amidohydrolase | CAH
Grado
BioReagent, EnzymoPure™
Especificaciones y pureza
BioReagent, EnzymoPure™, ≥90%(SDS-PAGE), ≥ 400 U/mg
Secuencia
GLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
CAS
9025-13-2
Número de la Comisión de Enzimas
3.5.2.10
Tipo de molécula
Enzyme
Almacenamiento y envío
Concentración
≥ 400 U/mg
Reconstitución
It is recommended to reconstitute with the buffer 5 mM Tris-HCl pH 8.0. It can also be reconstituted with sterile water, shake gently and do not vortex.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0421092Certificate of AnalysisMar 17, 2026 rp216173
ZJ25F0521339Certificate of AnalysisMar 17, 2026 rp216173
Preguntas frecuentes y artículos
Citations of This Product
Referencias
1. Fangbing Wang, Qiwen Peng, Yongheng Zhang, Min Zhang, Guoyue Shi.  (2026)  Five-in-one colorimetric multiplexed point-of-care testing of blood biomarkers via Janus separation-sensing membrane.  CHEMICAL ENGINEERING JOURNAL,      [PMID:] [10.1016/j.cej.2026.174104]
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View BioReagent grade guide → View EnzymoPure™ grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.