Determine the necessary mass, volume, or concentration for preparing a solution.
GIP(1-39) TFA, CAS No.725474-97-5(free)
Disponible para pedir
GRADE & PURITY ≥98%
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
Why this grade
≥98% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
GIP(1-39) TFA, CAS No.725474-97-5(free)
Sinónimos
Gastric Inhibitory Polypeptide (1-39)
Especificaciones y pureza
≥98%
Mecanismos bioquímicos y fisiológicos
Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreaticβ-cells than GIP.
Secuencia
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
Tipo de acción
AGONIST
CAS
725474-97-5(free)
Tipo de molécula
Peptide
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Desiccated
Enviado en
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas
Reseñas de cliente
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.