Lixisenatide acetate - ≥98% , CAS No.1997361-87-1

CAS: 1997361-87-1 Cat. No.: L275704 Peso molecular: 4858.49（free base）

GRADE & PURITY ≥98%

Synonyms

AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu

Storage

Store at -20°C,Argon charged

Shipped In

Ice chest + Ice pads

Descripción general

Shipped at 4°C. Store at -20°C.

Specifications

Sinónimos

AVE-010 | H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | AVE 010 | AVE0010 | LIXISENATIDE (MART.) | ZP 10 | H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu

Especificaciones y pureza

≥98%

Mecanismos bioquímicos y fisiológicos

Lixisenatide is a short acting, potent and selective short peptide-based GLP-1 receptor agonist. The in vivo half-life is\xa0 2-4 hours. Displays an IC 50 of 1.4 nM at the human GLP-1 receptor in in vitro binding assays.

Condiciones de almacenamiento de almacenamiento

Store at -20°C, Argon charged

Enviado en

Ice chest + Ice pads

Este producto requiere envío en cadena de frío. Los servicios terrestres y otros servicios económicos no están disponibles.

Pureza

≥98%

Nombres e identificadores

• CAS alternativo: CAS 320367-13-3 (free base)
• Peso molecular: 4858.49（free base）

Propiedades químicas y físicas

• Solubilidad: soluble in water to 100 mg/mL .
• Sensibilidad: Moisture sensitive