The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items PACAP 6-38 TFA, CAS No.143748-18-9(free base) 🧪
Why this grade ≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
🌡
Storage & shipping Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
📋
Quality documents SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
📚
Literature proof Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications Product Name
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
Especificaciones y pureza
≥95%
Mecanismos bioquímicos y fisiológicos
Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1antagonist (IC50= 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki= 1.5 nM). Antitumor activityin vivo.
Secuencia
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK(Modifications: Lys-33 = C-terminal amide)
CAS
143748-18-9(free base)
Almacenamiento y envío Condiciones de almacenamiento de almacenamiento
Store at -20°C,Desiccated
Enviado en
Ice chest + Ice pads
Documentation 📋 Safety Data Sheet (SDS) Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS → ✅ Certificate of Analysis (COA) Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA → 📊 Datasheet Quick-reference summary of product specifications and applications.
View datasheet → 🔬 Specification Sheet Full quality attributes and acceptance criteria for this grade.
View spec sheet →
Advanced Data Certificados (CoA, COO, BSE/TSE y tabla de análisis) Calculadoras de soluciones Molarity Calculator Determine the necessary mass, volume, or concentration for preparing a solution.
Dilution Calculator Determine the dilution needed to prepare a stock solution.
Reconstitution Calculator Reseñas
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.