Determine the necessary mass, volume, or concentration for preparing a solution.
Parathyroid hormone (1-34) (rat) TFA, CAS No.98614-76-7(free)
Disponible para pedir
GRADE & PURITY ≥98%
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
Why this grade
≥98% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
Parathyroid hormone (1-34) (rat) TFA, CAS No.98614-76-7(free)
Especificaciones y pureza
≥98%
Secuencia
AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
CAS
98614-76-7(free)
Tipo de molécula
Peptide
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Fecha | Articulo |
|---|---|---|---|
 K2519147 | Certificate of Analysis | Dec 03, 2025 | P407681 |
| I2205013 | Certificate of Analysis | Jun 09, 2025 | P407681 |
| I2205014 | Certificate of Analysis | Jun 09, 2025 | P407681 |
| I2205015 | Certificate of Analysis | Jun 09, 2025 | P407681 |
| I2205016 | Certificate of Analysis | Jun 09, 2025 | P407681 |
| I2205017 | Certificate of Analysis | Jun 09, 2025 | P407681 |
| I2205018 | Certificate of Analysis | Jun 09, 2025 | P407681 |
Calculadoras de soluciones
Reseñas
Reseñas de cliente
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.