Recombinant Human 4-1BB/TNFRSF9 Protein, >90% (SDS-PAGE)

Cat. No.: rp169624

GRADE & PURITY Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Expression System

HEK293

Accession #

Q07011

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured by its binding ability in a functional ELISA. Human 4-1BB/TNFRSF9 (rp169624) at 1.0 μg/mL can bind Urelumab (anti-TNFRSF9) (Ab170654) with the EC50 of 47.08 ng/mL.

Descripción general

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly on activated CD4+ and CD8+ T cells, and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor necrosis factor receptor–associated factors (TRAFs), the adaptor protein which mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses. In addition, CD137 and CD137L are expressed in different human primary tumor tissues, suggesting that they may influence the progression of tumors. Crosslinking of CD137 on activated T cells has shown promise in enhancing anti-tumor immune responses in murine models, and agonistic anti-CD137 antibodies are currently being tested in phase I clinical trials. Soluble forms of CD137 (sCD137) are generated by differential splicing. sCD137 can bind to CD137 ligand to antagonize the costimulatory activities of the membrane-bound CD137 and reduce T cell proliferation and IL-2 secretion.

Specifications

Product Name

Recombinant Human 4-1BB/TNFRSF9 Protein, >90% (SDS-PAGE)

Sinónimos

4-1BB ligand receptor | 41BB | 4-1BB | CD137 antigen | CD137 | CD137MGC2172 | CDw137 | FLJ43501 | ILA | ILAhomolog of mouse 4-1BB | induced by lymphocyte activation (ILA) | interleukin-activated receptor, homolog of mouse Ly63 | receptor protein 4-1BB | T

Grado

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Pureza

>90% (SDS-PAGE)

Bioactividad

Measured by its binding ability in a functional ELISA. Human 4-1BB/TNFRSF9 (rp169624) at 1.0 μg/mL can bind Urelumab (anti-TNFRSF9) (Ab170654) with the EC50 of 47.08 ng/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

HEK293

Aminoácidos

1-186 aa

Secuencia

MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

Q07011

Peso molecular previsto

18.1 kDa

SDS-PAGE

27.8-38.6 kDa, under reducing conditions; 28.4-37.9 kDa, under non-reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

ELISA: Recombinant Human 4-1BB/TNFRSF9 Protein (rp169624)

Recombinant Human 4-1BB/TNFRSF9 Protein (rp169624) - ELISA
Measured by its binding ability in a functional ELISA. Human 4-1BB/TNFRSF9 (rp169624) at 1.0 μg/mL can bind Urelumab (anti-TNFRSF9) (Ab170654) with the EC₅₀ of 47.08 ng/mL.

SDS-PAGE: Recombinant Human 4-1BB/TNFRSF9 Protein (rp169624)

Recombinant Human 4-1BB/TNFRSF9 Protein (rp169624) - SDS-PAGE
3 μg/lane of Recombinant Human 4-1BB/TNFRSF9 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 27.8-38.6 kDa under reducing conditions and 28.4-37.9 kDa under non-reducing conditions.