Recombinant Human ABCB1 Protein

Cat. No.: rp217147
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P08183
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp217147-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
50μg
rp217147-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
269,90US$
100μg
rp217147-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
429,90US$
1mg
rp217147-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,≥95%(SDS-PAGE),expressed in E. coli; See COA Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human ABCB1 Protein
Sinónimos
CD243 | P-glycoprotein 1 | ATP-dependent translocase ABCB1 | ABCB1 | ATP-binding cassette sub-family B member 1 | Multidrug resistance protein 1 (EC:7.6.2.2) | EC:7.6.2.2 | P-glycoprotein 1 | Phospholipid transporter ABCB1 (EC:7.6.2.1) | EC:7.6.2.1 | MDR1
Grado
Carrier Free
Especificaciones y pureza
Carrier Free, ≥95%(SDS-PAGE), expressed in E. coli; See COA
Mecanismos bioquímicos y fisiológicos
Translocates drugs and phospholipids across the membrane. Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membrane. Participates mainly to the flop of phosphatidylcholine, phosphatidylethanolamine, beta-D-g
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
624-708 aa
Secuencia
KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW
Número de adhesión
Peso molecular previsto
9.6 kDa
SDS-PAGE
15.3 kDa, under reducing conditions; 15.3 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli; See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human ABCB1 Protein (rp217147) - SDS-PAGE 
3 μg/lane of Recombinant Human ABCB1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.3 kDa under reducing and non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0535787Certificate of AnalysisMay 29, 2026 rp217147
ZJ26F0535786Certificate of AnalysisMay 29, 2026 rp217147
ZJ26F0535785Certificate of AnalysisMay 29, 2026 rp217147
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.