Recombinant Human Apolipoprotein E3 Protein

Cat. No.: rp214425
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) See COA
Accession #
P02649
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Apo-E Protein (rp214425) at 1.0 μg/mL can bind Recombinant Apolipoprotein E Antibody (Ab089341) with the EC50 of 645.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp214425-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
29,90US$
50μg
rp214425-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
89,90US$
100μg
rp214425-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
139,90US$
1mg
rp214425-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Apolipoprotein E3 Protein
Sinónimos
AD2 | Apo-E | ApoE4 | apolipoprotein E | Apolipoprotein E3 | LDLCQ5 | LPG
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His-Tag, ≥95%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Apolipoprotein E (ApoE) is a 34.2 kDa glycosylated protein with 299 amino acid residues. There are three isoforms in human (apoE2, apoE3, and apoE4) due to different amino acid residues at positions 112 and 158. ApoE is synthesized predominantly in the li
Bioactividad
Immobilized Recombinant Human Apo-E Protein (rp214425) at 1.0 μg/mL can bind Recombinant Apolipoprotein E Antibody (Ab089341) with the EC50 of 645.4 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-317 aa
Secuencia
MKVLWAALLVTFLAGCQA​KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHHHHHH
Número de adhesión
Peso molecular previsto
35.0 kDa
SDS-PAGE
29.9-34.8 kDa, under reducing conditions; 30.5-34.8 & 85.8 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human Apolipoprotein E3 Protein (rp214425) - ELISA
Immobilized Recombinant Human Apolipoprotein E3 Protein (rp214425) at 1.0 μg/mL can bind Recombinant Apolipoprotein E Antibody (Ab089341) with the EC₅₀ of 645.4 ng/mL.
Recombinant Human Apolipoprotein E3 Protein (rp214425) - SDS-PAGE 
3 μg/lane of Recombinant Human Apolipoprotein E3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 29.9-34.8 kDa under reducing conditions and 30.5-34.8 & 85.8 kDa under non-reducing conditions. Apolipoprotein-E3 forms dimers in human frontal cortex and hippocampus. (PMID: 20170526).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.