Recombinant Human APP/Protease Nexin II Protein

Cat. No.: rp231120
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. SUMO tag ? SUMO tag grade — recombinant protein bearing a SUMO tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. SUMO can boost expression and solubility. ≥85%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P05067
Protein Tag
N-His & SUMO
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp231120-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
50μg
rp231120-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
269,90US$
100μg
rp231120-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
429,90US$
1mg
rp231120-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,SUMO tag,≥85%(SDS-PAGE),expressed in E. coli; See COA Carrier Free,His Tag,SUMO tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human APP/Protease Nexin II Protein
Sinónimos
amyloid beta (A4) precursor protein-binding, family B, member 2 | amyloid beta A4 precursor protein-binding family B member 2 | Amyloid beta precursor protein | Amyloid beta | APP | beta Amyloid | Protease Nexin II | AAA | AD1 | PN2 | ABPP | APPI | CVAP |
Grado
Carrier Free, His Tag, SUMO tag
Especificaciones y pureza
Carrier Free, His Tag, SUMO tag, ≥85%(SDS-PAGE), expressed in E. coli; See COA
Mecanismos bioquímicos y fisiológicos
Amyloid precursor protein (APP) is a type I membrane protein with several human isoforms due to alternative splicing. APP-770, -751, and -733 contain a Kunitz protease inhibitor (KPI) domain (residue 291-342) and APP-695 does not. APP is a cell surface mo
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
18-289 aa
Secuencia
MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG/LEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRE​
Número de adhesión
Peso molecular previsto
44.3 kDa
SDS-PAGE
53.2 kDa, under reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli; See COA
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human APP/Protease Nexin II Protein (rp231120) - SDS-PAGE 
2 μg/lane of Recombinant Human APP/Protease Nexin II Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 53.2 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0333160Certificate of AnalysisMar 17, 2026 rp231120
ZJ26F0333159Certificate of AnalysisMar 17, 2026 rp231120
ZJ26F0333158Certificate of AnalysisMar 17, 2026 rp231120
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.