Recombinant Human B7-H3(4Ig)/B7-H3b Protein, >95% (SDS-PAGE)

Cat. No.: rp176244
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q5ZPR3
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1、Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC50 of 51.95 ng/mL. 2、Measured by its binding ability in a functional ELISA. Immobilized human Human B7-H3 (4Ig)/B7-H3b (rp176244) at 1.0 μg/mL can bind CD276 mouse mAb with the EC50 of 1.86 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp176244-10μg
≥10
127,90US$
50μg
rp176244-50μg
≥10
319,90US$
100μg
rp176244-100μg
3
519,90US$
1mg
rp176244-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Human B7 homolog 3 (B7-H3) is a member of the B7 family of immune proteins that provide signals for the regulation of immune responses. Other family members include B7-1, B7-2, B7-H1/PD-L1, B7-H2, and PD-L2. B7 family proteins are type I transmembrane immunoglobulin (Ig) superfamily members that contain extracellular Ig V‑like and Ig C‑like domains with a short cytoplasmic tail. Among the family members there is about 20 - 40% amino acid (aa) sequence identity. B7-H3 was initially reported to be a 316 aa type I transmembrane precursor protein that contained a signal sequence, an extracellular region with one V‑type and one C‑type Ig domain, a transmembrane segment and a short cytoplasmic tail. Subsequent studies have identified a second 110 kDa form whose precursor is 534 aa in length. Termed 4IgB7-H3 or B7-H3b, this molecule has two additional Ig-like domains (one V‑type and one C‑type) and shows a ubiquituous expression pattern. It would appear that the human 4Ig form is the principal, if not the only form of B7-H3. Its precursor contains a 26 aa signal sequence, a 435 aa extracellular region, a 31 aa transmembrane domain, and a 42 aa cytoplasmic tail. The four Ig-like domains alternate between V‑type and C‑type, and apparently are the consequence of a V‑C type tandem duplication. B7-H3b is expressed on dendritic cells as well as activated T, B and NK cells. The mouse gene differs from that of human in that it cannot code for four Ig-like domains; only a V‑type:C‑type pair. Human B7-H3b binding to an undefined receptor has shown to be inhibitory to NK cell illing and cytokine release. It also seems to be required for late stage osteoblast differentiation.

Specifications

Product Name
Recombinant Human B7-H3(4Ig)/B7-H3b Protein, >95% (SDS-PAGE)
Sinónimos
4Ig-B7-H3 | B7 homolog 3 | B7-H3 | Costimulatory molecule | 4Ig B7 H3 | 4Ig-B7-H3 | B7H34Ig-B7-H3 | B7-H3B7 homolog 3 | AU016588 | B7 H3 | B7 homolog 3 | B7-H3 | B7H3 | B7RP-2 | CD_antigen=CD276 | CD276 | CD276 antigen | CD276 molecule | CD276_HUMAN | Cos
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)
Pureza
>95% (SDS-PAGE)
Bioactividad
1、Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC50 of 51.95 ng/mL. 2、Measured by its binding ability in a functional ELISA. Immobilized human Human B7-H3 (4Ig)/B7-H3b (rp176244) at 1.0 μg/mL can bind CD276 mouse mAb with the EC50 of 1.86 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
29-461 aa
Secuencia
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTHHHHHHHHHH
Etiqueta proteínica
C-His
Secuencia N-terminal
Gly27
Número de adhesión
Peso molecular previsto
47.9 kDa
SDS-PAGE
63.2-82.3 kDa, under reducing conditions; 58.6-73.9 kDa, under non-reducing condition
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imágenes

ELISA: Recombinant Human B7-H3(4Ig)/B7-H3b Protein (rp176244)
Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC₅₀ of 51.95 ng/mL.

Recombinant Human B7-H3(4Ig)/B7-H3b Protein (rp176244) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human Human B7-H3 (4Ig)/B7-H3b (rp176244) at 1.0 μg/mL can bind CD276 mouse mAb with the EC₅₀ of 1.86 ng/mL.

Recombinant Human B7-H3(4Ig)/B7-H3b Protein (rp176244) - SDS-PAGE
3 μg/lane of Recombinant Human B7-H3(4Ig)/B7-H3b Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 63.2 - 82.3 kDa under reducing conditions and 58.6 - 73.9 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0202913Certificate of AnalysisOct 09, 2025 rp176244
ZJ24F0202914Certificate of AnalysisOct 09, 2025 rp176244
ZJ24F0202912Certificate of AnalysisMar 01, 2024 rp176244
ZJ24R0200289Certificate of AnalysisFeb 22, 2024 rp176244
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.