Recombinant Human BMP-4 GMP Protein

Cat. No.: rp164886-GMP
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) See COA
Expression System
E. coli
Accession #
P12644
Protein Tag
C-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Alkaline phosphatase production by ATDC-5 cells. ED50 approximately 95 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
50μg
rp164886-GMP-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.

1.148,90US$

1.479,90US$
Guardar 331,00 US$ (22.37%)
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Bone morphogenetic proteins (BMPs) are members of the transforming growth factor beta (TGF - β) superfamily. After Urist and other scholars first extracted a class of osteogenic protein components from decalcified bone in 1965, various bone morphogenetic proteins have been discovered, and their role in promoting osteogenesis has been discovered. Among them, human bone morphogenetic protein-4 (BMP-4), as a member of the BMPs family, has spatial consistency with the general structure of BMPs, except for its specificity in the mature region sequence. BMP-4 plays an important role in promoting bone tissue regeneration and repair. In addition, BMP4 is closely related to inducing embryonic differentiation, guiding neural stem cell differentiation, regulating tumor growth and invasion, and some cardiovascular and cerebrovascular diseases. The BMP4 precursor protein is composed of 400-500 amino acids, including three parts: N-terminal signal peptide, precursor protein folding region, and C-terminal mature peptide. The carboxyl terminal mature BMP4 protein can be cleaved from the precursor protein by Furin, PC6, and PC7, becoming a highly conserved BMP4 molecule consisting of 116 amino acids. Its C-terminus contains 7 cysteine residues, of which 6 form 3 intramolecular disulfide bonds called cysteine bonds. The 7th cysteine can undergo glycosylation, forming a covalent disulfide bond for dimerization with another monomer, thereby forming a biologically active signaling molecule.

Specifications

Product Name
Recombinant Human BMP-4 GMP Protein
Sinónimos
Bone Morphogenetic Protein 4 | BMP2B | BMP-2B | BMP2B1 | MCOPS6 | BMP4 | BMP-4 | Bone morphogenetic protein 2B | DVR4 | OFC11 | ZYME
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥95%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryo
Bioactividad
Alkaline phosphatase production by ATDC-5 cells. ED50 approximately 95 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
293-408 aa
Secuencia
MGSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRSSGLEHHHHHH
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
14.7 kDa
SDS-PAGE
14.7 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human BMP-4 GMP Protein (rp164886-GMP) - Protein Bioactivity
Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is approximately 95 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.