Recombinant Human CCL17/TARC Protein

Cat. No.: rp170428
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q92583
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170428-10μg
≥10
139,90US$
50μg
rp170428-50μg
2
399,90US$
100μg
rp170428-100μg
2
599,90US$
1mg
rp170428-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, ≥95%(SDS-PAGE) Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Chemokines are a family of small chemotactic cytokines, or proteins secreted by cells. Chemokines share the same structure similarities such as small size, and the presence of four cysteine residues in conserved locations in order to form their 3-dimensional shape. Some of the chemokines are considered pro-inflammatory which can be induced to recruit cells of the immune system to a site of infection during an immune response, while others are considered homeostatic and are implied in controlling the migration of cells during normal processes of tissue maintenance and development. There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4. 

Specifications

Product Name
Recombinant Human CCL17/TARC Protein
Sinónimos
ABCD-2 | CC chemokine TARC | C-C motif chemokine 17 | CCL17 | chemokine (C-C motif) ligand 17 | MGC138273 | SCYA17 | SCYA17MGC138271 | small inducible cytokine subfamily A (Cys-Cys), member 17 | Small-inducible cytokine A17 | T cell-directed CC chemokine
Grado
Carrier Free
Especificaciones y pureza
Carrier Free, ≥95%(SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
24-94 aa
Secuencia
GARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS​
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
8.1 kDa
SDS-PAGE
10.4 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human CCL17/TARC Protein (rp170428) - SDS-PAGE
1 μg/lane of Recombinant Human CCL17/TARC Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.4 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0707649Certificate of AnalysisFeb 11, 2026 rp170428
ZJ24F0707650Certificate of AnalysisFeb 11, 2026 rp170428
ZJ24F0707651Certificate of AnalysisFeb 11, 2026 rp170428
ZJ24R0600641Certificate of AnalysisJun 10, 2024 rp170428
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.