Recombinant Human CCL3/MIP-1 alpha Protein

Cat. No.: rp170414
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
P10147
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Determined by its ability to chemoattract human monocytes (THP-1) using a concentration range of 10.0-100.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170414-10μg
≥10
159,90US$
50μg
rp170414-50μg
6
439,90US$
100μg
rp170414-100μg
10
699,90US$
1mg
rp170414-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free, Bioactive, High performance, ≥90%(SDS-PAGE) Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
CCL3 is a cytokine belonging to the CC chemokine family. Chemokines are a family of structurally related leukocyte chemoattractant cytokines that play a central role during immunoregulatory and inflammation processes. All chemokines contain four conserved cysteines linked by disulfide bonds, and two major subfamilies, namely CXC and CC, are defined on the basis of the first two cysteines which are separated by one amino acid or are adjacent. CCL3 is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes.

Specifications

Product Name
Recombinant Human CCL3/MIP-1 alpha Protein
Sinónimos
C-C motif chemokine 3 | MIP1-(a) | AI323804 | CCL3 | chemokine (C-C motif) ligand 3 | G0S19-1 | LD78a | LD78alpha | MIP1 alpha | MIP-1 alpha | MIP1A | MIP-1alpha | MIP1-alpha | PAT 464.1 | SCYA3 | SIS-beta
Grado
Bioactive, Carrier Free, High Performance
Especificaciones y pureza
Carrier Free, Bioactive, High performance, ≥90%(SDS-PAGE)
Bioactividad
Determined by its ability to chemoattract human monocytes (THP-1) using a concentration range of 10.0-100.0 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
27-92 aa
Secuencia
SADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
7.5 kDa
SDS-PAGE
11.0 kDa, under reducing conditions; 11.0-11.4 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human CCL3/MIP-1 alpha Protein (rp170414) - Protein Bioactivity
Determined by its ability to chemoattract human monocytes (THP-1) using a concentration range of 10.0-100.0 ng/mL.

Recombinant Human CCL3/MIP-1 alpha Protein (rp170414) - SDS-PAGE
1 μg/lane of Recombinant Human CCL3/MIP-1 alpha Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 11.0 kDa under reducing conditions and 11.0-14.0 kDa under non-reducing conditions.


Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0606716Certificate of AnalysisJun 14, 2024 rp170414
ZJ24F0606715Certificate of AnalysisJun 14, 2024 rp170414
ZJ24F0606714Certificate of AnalysisJun 14, 2024 rp170414
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.