Recombinant Human CCL4/MIP-1 beta Protein

Cat. No.: rp170426
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥90%(SDS-PAGE) See COA
Accession #
P13236
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0 - 20.0 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170426-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
89,90US$
50μg
rp170426-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
269,90US$
100μg
rp170426-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
429,90US$
1mg
rp170426-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,High Performance,≥90%(SDS-PAGE),See COA ActiBioPure™,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CCL4/MIP-1 beta Protein
Sinónimos
Small inducible cytokine A4 | CCL4 | Macrophage inflammatory protein 1-beta | MIP-1- beta | MIP-1-beta(1-69) | T-cell activation protein 2 | ACT-2 | PAT 744 | H400 | SIS-gamma | Lymphocyte activation gene 1 protein | LAG-1 | HC21 | G-26 T-lym
Grado
ActiBioPure™, Bioactive, Carrier Free, High Performance
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥90%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
CCL4 (C-C chemokine ligand 4), is a macrophage inflammatory protein with a chief effect in inflammation and immune-regulation, and was documented in cancer progression by promoting instability in the tumor environment. The inflammatory chemokine (C-C moti
Bioactividad
Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0 - 20.0 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
24-92 aa
Secuencia
SAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Número de adhesión
Peso molecular previsto
7.9 kDa
SDS-PAGE
14.1 & 18.7 kDa, under reducing conditions; 12.3 & 17.8 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human CCL4/MIP-1 beta Protein (rp170426) - SDS-PAGE 
3 μg/lane of Recombinant Human CCL4/MIP-1 beta Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the bands at 14.1 & 18.7 kDa under reducing conditions and 12.3 & 17.8 kDa under non-reducing conditions. CCL4/MIP-1 beta Protein belongs to the chemokine family, and these proteins often form dimers or multimers through disulfide bonds (Uniprot ID: P13236).
Recombinant Human CCL4/MIP-1 beta Protein (rp170426) - Protein Bioactivity 
Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0-20.0 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0131603Certificate of AnalysisJan 28, 2026 rp170426
ZJ26F0131602Certificate of AnalysisJan 28, 2026 rp170426
ZJ26F0131601Certificate of AnalysisJan 28, 2026 rp170426
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.