Recombinant Human CD14 Protein, >95%(SDS-PAGE)

Cat. No.: rp143803
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P08571,NP_000582.1
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 5.7‑23 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp143803-10μg
≥10
111,90US$
50μg
rp143803-50μg
8
271,90US$
100μg
rp143803-100μg
3
438,90US$
1mg
rp143803-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.995,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:
>95%(SDS-PAGE)

Function:
Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

Background:
CD14 is a 55 kDa cell surface glycoprotein that is preferentially expressed on monocytes/macrophages. The human CD14 cDNA encodes a 375 amino acid (aa) residue precursor protein with a 19 aa signal peptide and a C-terminal hydrophobic region characteristic for glycosylphosphatidyinositol (GPI)-anchored proteins. Human CD14 has four potential N-linked glycosylation sites and also bears O-linked carbohydrates. The amino acid sequence of human CD14 is approximately 65% identical with the mouse, rat, rabbit, and bovine proteins. CD14 is a pattern recognition receptor that binds lipopolysaccharides (LPS) and a variety of ligands derived from different microbial sources. The binding of CD14 with LPS is catalyzed by LPS-binding protein (LBP). The toll-like-receptors have also been implicated in the transduction of CD14-LPS signals. Similar to other GPI-anchored proteins, soluble CD14 can be released from the cell surface by phosphatidyinositol-specific phospholipase C. Soluble CD14 has been detected in serum and body fluids. High concentrations of soluble CD14 have been shown to inhibit LPS-mediated responses. However, soluble CD14 can also potentiate LPS response in cells that do not express cell surface CD14.

Specifications

Product Name
Recombinant Human CD14 Protein, >95%(SDS-PAGE)
Sinónimos
CD14 antigen | CD14 molecule | CD14 | monocyte differentiation antigen CD14 | Myeloid cell-specific leucine-rich glycoprotein | CD_antigen=CD14 | CD14_HUMAN | LPS-R | Mo2 | Monocyte differentiation antigen CD14 urinary form | Monocyte differentiation anti
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Pureza
>95%(SDS-PAGE)
Bioactividad
Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 5.7‑23 ng/mL.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
20-352 aa
Secuencia
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACHHHHHH
Etiqueta proteínica
C-His
Conjugación
Unconjugated
Número de adhesión
Peso molecular previsto
37 kDa
SDS-PAGE
45-55 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is recommended to reconstitute to a concentration 0f 0.1-1mg/mL. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store it under sterile conditions at -20℃~ -80℃ for more than 1 year.It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles
Imágenes

Recombinant Human CD14 Protein (rp143803) - Protein Bioactivity
Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 12.3 ng/mL.


Recombinant Human CD14 Protein (rp143803) - SDS-PAGE
2.5 μg/lane of Recombinant Human CD14 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 47.7 kDa under reducing condition and 47.7 & 87.2 kDa under non-reducing condition.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F1201897Certificate of AnalysisApr 13, 2026 rp143803
ZJ23F1201898Certificate of AnalysisApr 13, 2026 rp143803
ZJ23F1201899Certificate of AnalysisApr 13, 2026 rp143803
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.