Recombinant Human CD277/BTN3A1 Protein, ≥95% (SDS-PAGE)

Cat. No.: rp143418
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
O00481
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat. The ED₅₀ for this effect is 20-100 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp143418-10μg
≥10
139,90US$
50μg
rp143418-50μg
3
409,90US$
100μg
rp143418-100μg
1
549,90US$
1mg
rp143418-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.799,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Background:
Butyrophilin 3A1 (also called BTN3A1) is a 57 kDa type I transmembrane glycoprotein member of the Ig superfamily. It is expressed on a wide variety of immune cells. Similar to BTN3A2 and BTN3A3, BTN3A1 (484 amino acids) is composed of an extracellular N-terminal IgV and a membrane-proximal IgC domain followed by a transmembrane domain and a cytoplasmic tail. These Ig domains are also found in B7 family co-stimulatory molecules, suggesting structural and functional similarities between the two protein families. The intracellular portion of BTN3A1 contains a B30.2 domain. Although the B30.2 domain of BTN1A1 binds to xanthine oxidoreductase (XOR) and is conserved among BTN1A1 orthologs, this interaction with XOR is not shared by BTN3A1. The B30.2 domain of butyrophilins also functions as a sensor for detecting changes in intracellular phopho-antigen (pAg) concentrations produced during tumorigenesis and microbial infections. The specific binding of pAg by the B30.2 domain of BTN3A1 induces a conformational change in its ECD, leading to the activation of V gamma 9Vδ2 T cells. Thus, BTN3A1 acts as a critical protein for the activation of V gamma 9Vδ2 T cells following detection of distressed cells. The anti-tumor responses of V gamma 9Vδ2 T cells may be enhanced with agonistic anti-BTNA3 antibodies. No BTN3A1 homolog has yet been identified in rodents. However, Human BTN3A1 shares 92.4% and 91.6% sequence identity with baboon and rhesus monkey BTN3A1 respectively.

Specifications

Product Name
Recombinant Human CD277/BTN3A1 Protein, ≥95% (SDS-PAGE)
Sinónimos
BT3.1 | BTF5 | BTN3A1 | Butyrophilin, Subfamily 3, member A1 | CD277 | DJ45P21.3 (Butyrophilin, subfamily 3, member A1) | BT3.1 | BTF5 | BTN3A1 | butyrophilin, subfamily 3, member A1 | CD277 | dJ45P21.3 (butyrophilin, subfamily 3, member A1) | BTN3.1
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Pureza
≥95% (SDS-PAGE)
Bioactividad
Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat. The ED₅₀ for this effect is 20-100 ng/mL.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
30-254 aa
Secuencia
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Etiqueta proteínica
C-hFc & His
Número de adhesión
Peso molecular previsto
52 kDa
SDS-PAGE
58 kDa, under reducing conditions; 116 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human CD277/BTN3A1 Protein (rp143418) - SDS-PAGE
3 μg/lane of Recombinant Human CD277/BTN3A1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 58 kDa under reducing condition and 116 kDa under non-reducing condition.

Recombinant Human CD277/BTN3A1 Protein (rp143418) - Protein Bioactivity
Measured by its ability to inhibit Anti-CD3-induced proliferation of Jurkat cells. The ED₅₀ for this effect is 55.72 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.