Recombinant Human CD40/TNFRSF5 Protein

Cat. No.: rp183577
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P25942
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Recombinant Human CD40 Ligand Protein (rp169583) with the EC50 of 20.84 ng/mL.     Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind CD40 Mouse mAb (Ab094764) with the EC50 of 15.35 ng/mL. Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Ravagalimab (anti-CD40) (Ab182860) with the EC50 of 11.32 ng/mL. Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Mitazalimab (anti-CD40) (Ab182809) with the EC50 of 4.37 ng/mL. Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Giloralimab (anti-CD40) (Ab182875) with the EC50 of 25.5 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp183577-10μg
4
89,90US$
50μg
rp183577-50μg
4
269,90US$
100μg
rp183577-100μg
3
429,90US$
1mg
rp183577-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins. CD40 protein plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 protein is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Defects in CD40 result in hyper-IgM immunodeficiency type 3 (HIGM3). In addition, CD40/CD40L interaction is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. 

Specifications

Product Name
Recombinant Human CD40/TNFRSF5 Protein
Sinónimos
B cell surface antigen CD40 | B-cell surface antigen CD40 | Bp50B cell-associated molecule | CD40 antigen | CD40 molecule, TNF receptor superfamily member 5 | CD40 type II isoform | CD40 | CD40L receptor | CDw40 | MGC9013 | nerve growth factor receptor-re
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Recombinant Human CD40 Ligand Protein (rp169583) with the EC50 of 20.84 ng/mL.     Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind CD40 Mouse mAb (Ab094764) with the EC50 of 15.35 ng/mL. Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Ravagalimab (anti-CD40) (Ab182860) with the EC50 of 11.32 ng/mL. Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Mitazalimab (anti-CD40) (Ab182809) with the EC50 of 4.37 ng/mL. Immobilized Recombinant Human CD40 Protein (rp183577) at 1.0 μg/mL can bind Giloralimab (anti-CD40) (Ab182875) with the EC50 of 25.5 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-193 aa
Secuencia
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
20.0 kDa
SDS-PAGE
28.7 kDa, under reducing conditions; 27.9 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human CD40/TNFRSF5 Protein (rp183577) - Binding Activity
Immobilized Recombinant Human CD40/TNFRSF5 Protein (rp183577) at 1.0 μg/mL can bind Recombinant Human CD40 Ligand Protein (rp169583) with the EC₅₀ of 20.84 ng/mL.

Recombinant Human CD40/TNFRSF5 Protein (rp183577) - ELISA
Immobilized Recombinant Human CD40/TNFRSF5 Protein (rp183577) at 1.0 μg/mL can bind CD40 Mouse mAb (Ab094764) with the EC₅₀ of 15.35 ng/mL.


Recombinant Human CD40/TNFRSF5 Protein (rp183577) - ELISA
Immobilized Recombinant Human CD40/TNFRSF5 Protein (rp183577) at 1.0 μg/mL can bind Ravagalimab (anti-CD40) (Ab182860) with the EC₅₀ of 11.32 ng/mL.


Recombinant Human CD40/TNFRSF5 Protein (rp183577) - ELISA
Immobilized Recombinant Human CD40/TNFRSF5 Protein (rp183577) at 1.0 μg/mL can bind Mitazalimab (anti-CD40) (Ab182809) with the EC₅₀ of 4.37 ng/mL.


Recombinant Human CD40/TNFRSF5 Protein (rp183577) - ELISA
Immobilized Recombinant Human CD40/TNFRSF5 Protein (rp183577) at 1.0 μg/mL can bind Giloralimab (anti-CD40) (Ab182875) with the EC₅₀ of 25.5 ng/mL.

Recombinant Human CD40/TNFRSF5 Protein (rp183577) - SDS-PAGE
3 μg/lane of Recombinant Human CD40/TNFRSF5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.7 kDa under reducing conditions and 27.9 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1011702Certificate of AnalysisMay 21, 2026 rp183577
ZJ24F1011703Certificate of AnalysisMay 21, 2026 rp183577
ZJ24F1011704Certificate of AnalysisMay 21, 2026 rp183577
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.