Recombinant Human CD7 Protein

Cat. No.: rp176728
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P09564
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CD7 protein (rp176728) at 1.0 μg/mL can bind CD7 Mouse mAb (Ab095225) with the EC50 of 53.82 ng/mL.
Size
USA
Alemania (EU)*
Price
Qty
10μg
rp176728-10μg
Disponible ≥10
125,90US$
50μg
rp176728-50μg
7 Disponible
379,90US$
100μg
rp176728-100μg
7 Disponible
599,90US$
1mg
rp176728-1mg
1 Disponible
2.735,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily. Mature human CD7 consists of a 155 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 39 aa cytoplasmic domain. Within the ECD, human CD7 shares 43% and 41% aa sequence identity with mouse and rat CD7, respectively. CD7 is expressed on T cells, NK cells, myeloid progenitor cells, and CD19+ B progenitor cells. Among CD8+ T cells, the CD7-bright population preferentially contains naïve and memory cells, while more weak expressors are primarily effector cells. CD7 associates in cis with CD3 and CD45 and in trans with SECTM1. Ligation of CD7 with antibodies or SECTM1 co‑stimulates the activation and proliferation of CD4+ and CD8+ T cells and NK cells. It also enhances integrin-mediated adhesion of these cells to Fibronectin, ICAM-1, and VCAM-1. CD7 additionally mediates the Galectin-1 induced apoptosis of T cells and facilitates the fusion of HIV-1 with target cells.

Specifications

Product Name
Recombinant Human CD7 Protein
Sinónimos
CD7 antigen | CD7 | CD7 antigen (p41) | CD7 molecule | CD7_HUMAN | GP40 | LEU 9 | LEU9 | p41 protein | T cell antigen CD7 | T cell leukemia antigen | T cell surface antigen Leu 9 | T-cell antigen CD7 | T-cell leukemia antigen | T-cell surface antigen Leu-
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, PBS Only, ≥95%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human CD7 protein (rp176728) at 1.0 μg/mL can bind CD7 Mouse mAb (Ab095225) with the EC50 of 53.82 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-180 aa
Secuencia
MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
16.4 kDa
SDS-PAGE
22.3-39.5 kDa, under reducing conditions; 22.8-38.0 & 21.7 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human CD7 Protein (rp176728) - ELISA
Immobilized Recombinant Human CD7 Protein (rp176728) at 1.0 μg/mL can bind CD7 Mouse mAb (Ab095225) with the EC50 of 53.82 ng/mL.

Recombinant Human CD7 Protein (rp176728) - SDS-PAGE
3 μg/lane of Recombinant Human CD7 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 22.3-39.5 kDa under reducing conditions and 22.8-38.0 & 21.7 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0809488Certificate of AnalysisMar 13, 2026 rp176728
ZJ24F0809489Certificate of AnalysisMar 13, 2026 rp176728
ZJ24F0809490Certificate of AnalysisMar 13, 2026 rp176728
ZJ24F0809491Certificate of AnalysisMar 13, 2026 rp176728
ZJ24R0800865Certificate of AnalysisAug 02, 2024 rp176728
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.