Recombinant Human CD72 Protein

Cat. No.: rp181592

GRADE & PURITY Animal Free, Carrier Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Expression System

HEK293

Accession #

P21854

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

CD72, also known as Lyb‑2, is a 40‑45 kDa type II transmembrane glycoprotein that plays a role in immune system regulation. Mature human CD72 consists of a 95 amino acid (aa) cytoplasmic domain with two immunoreceptor tyrosine‑based inhibitory motifs (ITIMs), a 21 aa transmembrane segment, and a 243 aa extracellular domain with a coiled‑coil domain and a C‑type lectin domain. Within the ECD, human CD72 shares 48% and 44% aa sequence identity with mouse and rat CD72, respectively. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 binds to CD5 with mouse/human cross‑reactivity and to Semaphorin 4D/CD100. It associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP‑1. CD72 ligation with antibodies or with Semaphorin 4D induces tyrosine dephosphorylation of the CD72 cytoplasmic domain and its dissociation from SHP‑1, leading to B cell proliferation. Both CD72 and Semaphorin 4D are required for the maintenance of B cell anergy and the regulation of peripheral B cell tolerance as shown by the development of autoimmunity in mice that lack either molecule. In addition to its negative regulation of BCR signaling, CD72 can induce positive signaling in B cells independent of the BCR. CD72 binding to Semaphorin 4D induces cytokine production by monocytes and dendritic cells, inhibits SCF R/c‑kit induced mast cell proliferation and activation, and inhibits the cytolytic activity of NK cells. Semaphorin 4D is expressed on activated NK cells and contributes to the adhesive interaction between NK and CD72+ target cells leading to a more efficient killing and enhanced IFN-gamma secretion.

Specifications

Product Name

Recombinant Human CD72 Protein

Sinónimos

CD72 antigen | B-cell differentiation antigen CD72 | B cell differentiation antigen CD72 | CD72 molecule | CD72_HUMAN | CD72 | CD72b | Ly-19.2 | Ly-32.2 | Lyb-2 | LYB2 | lyb-2 | Lyb2

Grado

Animal Free, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Animal Free, Carrier Free, His Tag, PBS Only, ≥90%(SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

HEK293

Aminoácidos

117-359 aa

Secuencia

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDHHHHHH

Etiqueta proteínica

C-His

Número de adhesión

P21854

Peso molecular previsto

28.9 kDa

SDS-PAGE

30.6-37.0 kDa, under reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human CD72 Protein (rp181592)

Recombinant Human CD72 Protein (rp181592) - SDS-PAGE
3 μg/lane of Recombinant Human CD72 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 30.6-37.0 kDa.