Recombinant Human CD72 Protein

Cat. No.: rp181592
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P21854
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp181592-10μg
≥10
139,90US$
50μg
rp181592-50μg
2
399,90US$
100μg
rp181592-100μg
2
599,90US$
1mg
rp181592-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,His Tag,PBS Only,≥90%(SDS-PAGE) Animal Free,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

CD72, also known as Lyb‑2, is a 40‑45 kDa type II transmembrane glycoprotein that plays a role in immune system regulation. Mature human CD72 consists of a 95 amino acid (aa) cytoplasmic domain with two immunoreceptor tyrosine‑based inhibitory motifs (ITIMs), a 21 aa transmembrane segment, and a 243 aa extracellular domain with a coiled‑coil domain and a C‑type lectin domain. Within the ECD, human CD72 shares 48% and 44% aa sequence identity with mouse and rat CD72, respectively. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 binds to CD5 with mouse/human cross‑reactivity and to Semaphorin 4D/CD100. It associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP‑1. CD72 ligation with antibodies or with Semaphorin 4D induces tyrosine dephosphorylation of the CD72 cytoplasmic domain and its dissociation from SHP‑1, leading to B cell proliferation. Both CD72 and Semaphorin 4D are required for the maintenance of B cell anergy and the regulation of peripheral B cell tolerance as shown by the development of autoimmunity in mice that lack either molecule. In addition to its negative regulation of BCR signaling, CD72 can induce positive signaling in B cells independent of the BCR. CD72 binding to Semaphorin 4D induces cytokine production by monocytes and dendritic cells, inhibits SCF R/c‑kit induced mast cell proliferation and activation, and inhibits the cytolytic activity of NK cells. Semaphorin 4D is expressed on activated NK cells and contributes to the adhesive interaction between NK and CD72+ target cells leading to a more efficient killing and enhanced IFN-gamma secretion.

Specifications

Product Name
Recombinant Human CD72 Protein
Sinónimos
CD72 antigen | B-cell differentiation antigen CD72 | B cell differentiation antigen CD72 | CD72 molecule | CD72_HUMAN | CD72 | CD72b | Ly-19.2 | Ly-32.2 | Lyb-2 | LYB2 | lyb-2 | Lyb2
Grado
Animal Free, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, His Tag, PBS Only, ≥90%(SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
117-359 aa
Secuencia
RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
28.9 kDa
SDS-PAGE
30.6-37.0 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human CD72 Protein (rp181592) - SDS-PAGE
3 μg/lane of Recombinant Human CD72 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 30.6-37.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0707709Certificate of AnalysisFeb 24, 2026 rp181592
ZJ24F0707710Certificate of AnalysisFeb 24, 2026 rp181592
ZJ24F0707711Certificate of AnalysisFeb 24, 2026 rp181592
ZJ24R0600646Certificate of AnalysisJun 10, 2024 rp181592
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.