Proteína CD79B humana recombinante

Cat. No.: rp176729
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
P40259
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
1. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC50 of 11.08 ng/mL. 2. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC50 of 51.95 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp176729-10μg
7
89,90US$
50μg
rp176729-50μg
3
265,90US$
100μg
rp176729-100μg
1
439,90US$
1mg
rp176729-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.079,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, bioactivo, sin animales, sin portador, ≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Conservar a -20°C,Evitar la congelación y descongelación repetidas Ships Hielera + almohadillas de hielo Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Se requiere en cooperación con CD79A para el inicio de la cascada de transducción de señales activada por el complejo receptor de antígeno de células B (BCR) que conduce a la internalización del complejo, el tráfico a endosomas tardíos y la presentación de antígenos. Potencia la fosforilación de CD79A, posiblemente mediante el reclutamiento de quinasas que fosforilan CD79A o mediante el reclutamiento de proteínas que se unen a CD79A y lo protegen de la desfosforilación.

Specifications

Product Name
Proteína CD79B humana recombinante
Sinónimos
Cadena beta de la proteína asociada al complejo receptor de antígenos de células B | Cadena beta de la proteína asociada al complejo receptor de antígenos de células B | Glicoproteína específica de células B B29 | B29 | B29/Ig-beta/CD79b | CD 79b | CD79b
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, His Tag, PBS Only
Especificaciones y pureza
ActiBioPure™, bioactivo, sin animales, sin portador, ≥90%(SDS-PAGE)
Bioactividad
1. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC50 of 11.08 ng/mL. 2. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC50 of 51.95 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-159 aa
Secuencia
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH
Etiqueta proteínica
C-His
Secuencia N-terminal
Ala29
Número de adhesión
Peso molecular previsto
16.0 kDa
SDS-PAGE
26.8-38.0 kDa, under reducing conditions; 28.8-34.6 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Conservar a -20°C,Evitar la congelación y descongelación repetidas
Enviado en
Hielera + almohadillas de hielo
Estabilidad y almacenamiento
Conservar a -20°C durante 1 año. Evitar el ciclo de congelación/descongelación.
Imágenes

Recombinant Human CD79B Protein (rp176729) - ELISA
Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC₅₀ of 11.08 ng/mL.

Recombinant Human CD79B Protein (rp176729) - ELISA
Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC₅₀ of 51.95 ng/mL.

Recombinant Human CD79B Protein (rp176729) - SDS-PAGE
3 μg/lane of Recombinant Human CD79B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.8-38.0 kDa under reducing conditions and 28.8-34.6 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0708338Certificate of AnalysisFeb 11, 2026 rp176729
ZJ24F0708339Certificate of AnalysisFeb 11, 2026 rp176729
ZJ24F0708340Certificate of AnalysisFeb 11, 2026 rp176729
ZJ24R0700768Certificate of AnalysisJul 06, 2024 rp176729
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.