Recombinant Human CD8B Protein

Cat. No.: rp330616
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P10966
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CD8B Protein (rp188222) at 1.0 μg/mL can bind CD8 beta Antibody (Ab095390) with the EC50 of 874.3 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp330616-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
151,90US$
50μg
rp330616-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
479,90US$
100μg
rp330616-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
759,90US$
1mg
rp330616-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
3.339,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,His Tag,Fc tag,PBS Only,≥90%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CD8B Protein
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, His Tag, Fc tag, PBS Only, ≥90%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide com
Bioactividad
Immobilized Recombinant Human CD8B Protein (rp188222) at 1.0 μg/mL can bind CD8 beta Antibody (Ab095390) with the EC50 of 874.3 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-170 aa
Secuencia
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPLEVLFQGPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH​
Número de adhesión
Peso molecular previsto
44.3 kDa
SDS-PAGE
45.0-55.0 kDa, under reducing conditions; 100.0-125.0 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months.Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human CD8B Protein (rp188222) - ELISA
Immobilized Recombinant Human CD8B Protein (rp188222) at 1.0 μg/mL can bind CD8 beta Antibody (Ab095390) with the EC50 of 874.3 ng/mL.

Recombinant Human CD8B Protein (rp188222) - SDS-PAGE
3 μg/lane of Recombinant Human CD8B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 45.0-55.0 kDa under reducing conditions and 100.0-125.0 kDa under non-reducing conditions.
Fc fusion proteins can be linked by disulfide bonds in the Fc hinge region to form stable dimers (PMID: 23665380).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.