Recombinant Human CDC42 Protein

Cat. No.: rp188344
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. GST Tag ? GST tag grade — recombinant protein bearing a GST tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P60953
Protein Tag
N-GST & His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CDC42 Protein (rp188344) at 1.0 μg/mL can bind Recombinant CDC42 Antibody (Ab095633) with the EC50 of 7.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp188344-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
59,90US$
50μg
rp188344-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
139,90US$
100μg
rp188344-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
219,90US$
1mg
rp188344-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.699,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His Tag,GST Tag,≥95%(SDS-PAGE),expressed in E. coli; See COA ActiBioPure™,Bioactive,Carrier Free,GST Tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CDC42 Protein
Sinónimos
Cell division control protein 42 homolog | G25K GTP-binding protein | CDC42 | G25K | TKS | CDC42Hs
Grado
ActiBioPure™, Bioactive, Carrier Free, GST Tag, His Tag
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, His Tag, GST Tag, ≥95%(SDS-PAGE), expressed in E. coli; See COA
Mecanismos bioquímicos y fisiológicos
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. R
Bioactividad
Immobilized Recombinant Human CDC42 Protein (rp188344) at 1.0 μg/mL can bind Recombinant CDC42 Antibody (Ab095633) with the EC50 of 7.4 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
2-188 aa
Secuencia
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGENLYFQGQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
Número de adhesión
Peso molecular previsto
48.9 kDa
SDS-PAGE
44.0 kDa; under reducing conditions; 44.0 kDa; under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli; See COA
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon receipt; it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human CDC42 Protein (rp188344) - ELISA
Immobilized Recombinant Human CDC42 Protein (rp188344) at 1.0 μg/mL can bind Recombinant CDC42 Antibody (Ab095633) with the EC₅₀ of 7.4 ng/mL.
Recombinant Human CDC42 Protein (rp188344) - SDS-PAGE 
3 μg/lane of Recombinant Human CDC42 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 44.0 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0535104Certificate of AnalysisMay 07, 2026 rp188344
ZJ26F0535105Certificate of AnalysisMay 07, 2026 rp188344
ZJ26F0535106Certificate of AnalysisMay 07, 2026 rp188344
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.