Recombinant Human CDX2 Protein

Cat. No.: rp214416
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥85%(SDS-PAGE) See COA
Accession #
Q99626
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp214416-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
179,90US$
50μg
rp214416-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
539,90US$
100μg
rp214416-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
859,90US$
1mg
rp214416-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥85%(SDS-PAGE),See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human CDX2 Protein
Sinónimos
Caudal type homeo box 2 | Caudal type homeo box transcription factor 2 | Caudal type homeobox 2 | Caudal type homeobox protein 2 | Caudal type homeobox transcription factor 2 | Caudal-type homeobox protein 2 | CDX 2 | CDX 3 | CDX-3 | Cdx2 | CDX2/AS | CDX2
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His-Tag, ≥85%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
54-249 aa
Secuencia
MHHHHHHNLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKL
Número de adhesión
Peso molecular previsto
22.4 kDa
SDS-PAGE
26.1 & 47.2 & 50.7 kDa, under reducing conditions; 25.3 & 26.6 & 45.7 & 50.9 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human CDX2 Protein (rp214416) - SDS-PAGE
3 μg/lane of Recombinant Human CDX2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.1 & 47.2 & 50.7 kDa under reducing conditions and 25.3 & 26.6 & 45.7 & 50.9 kDa under non-reducing conditions.
CDX2 binds as a dimer to its regulatory element and that dimerization in vitro is dependent on redox potential (PMID: 7935448).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.