Recombinant Human Cerebellin-1 Protein

Cat. No.: rp167360
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P23435
Protein Tag
N-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human Cerebellin-1 is coated at 5 μg/mL, biotinylated recombinant rat NRXN-1 beta binds with an apparent KD < 0.5 nM. Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Recombinant Human Cerebellin-1, immobilized at 3-30 μg/mL, is able to significantly enhance neurite outgrowth.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp167360-10μg
7
271,90US$
50μg
rp167360-50μg
3
817,90US$
100μg
rp167360-100μg
1
1.311,90US$
1mg
rp167360-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
6.499,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Function
Required for synapse integrity and synaptic plasticity. During cerebellar synapse formation, essential for the formation and maintenance of parallel fiber and Purkinje cell synapses. When parallel fibers make contact with Purkinje spines, CBLN1 interaction with GRID2 triggers the recruitment of NRXN1 and secretory vesicles to the sites of contact. NRXN1-CBLN1-GRID2 signaling induces presynaptic morphological changes, which may further accumulate pre- and postsynaptic components to promote bidirectional maturation of parallel fiber - Purkinje cell functionnally active synapses by a positive feedback mechanism. Required for CBLN3 export from the endoplasmic reticulum and secretion. The cerebellin peptide exerts neuromodulatory functions. Directly stimulates norepinephrine release via the adenylate cyclase/PKA-dependent signaling pathway; and indirectly enhances adrenocortical secretion in vivo, through a paracrine mechanism involving medullary catecholamine release.

Specifications

Product Name
Recombinant Human Cerebellin-1 Protein
Sinónimos
CBLN1 | cerebellin 1 precursor | Cerebellin1 | Cerebellin-1 | CLN1 | Precerebellin
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His-Tag, ≥95%(SDS-PAGE)
Bioactividad
Measured by its binding ability in a functional ELISA. When Recombinant Human Cerebellin-1 is coated at 5 μg/mL, biotinylated recombinant rat NRXN-1 beta binds with an apparent KD < 0.5 nM. Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Recombinant Human Cerebellin-1, immobilized at 3-30 μg/mL, is able to significantly enhance neurite outgrowth.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Aminoácidos
22-193 aa
Secuencia
HHHHHHQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
20 kDa
SDS-PAGE
30-35 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human Cerebellin-1 Protein (rp167360) - SDS-PAGE
2 μg/lane of Recombinant Human Cerebellin-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40 - 50 & 100 - 125 kDa.
The structural hallmark of Cerebellin-1 is its triple disulfide-bonded hexameric topology, characterized by a trimer-trimer interface locked via N-terminal Cys²⁷ residues. This architecture enables bivalent receptor binding to orchestrate synaptic organization, establishing Cbln1 as a paradigm of disulfide-mediated higher-order assembly within the C1q/TNF superfamily (PubMed:27418511).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0116537Certificate of AnalysisJan 08, 2025 rp167360
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.