Recombinant Human Complement Component C3a Protein

Cat. No.: rp183573
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Accession #
P01024
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
★
Size
USA
Alemania (EU)*
Price
Qty
10μg
rp183573-10μg
2 Disponible
—
169,90US$
50μg
rp183573-50μg
1 Disponible
—
599,90US$
100μg
rp183573-100μg
1 Disponible
—
899,90US$
1mg
rp183573-1mg
Fabricado bajo pedido en EE. UU. · 2–4 semanas ·
—
4.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,PBS Only,≥95%(SDS-PAGE) Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Complement Component C3a Protein
Sinónimos
AHUS5 | ARMD9 | ASP | C3a | C3b | Complement C3 | CPAMD1 | HEL-S-62p | Anaphylatoxin | C3 | Complement Component C3a
Grado
Carrier Free, PBS Only
Especificaciones y pureza
Carrier Free,PBS Only,≥95%(SDS-PAGE)
Mecanismos bioquímicos y fisiológicos
C3a is an anaphylotoxin polypeptide comprising amino acids (aa) 672-748 of the Complement C3 precursor protein. Anaphylatoxins are proteolytically generated from the C3, C4 and C5 alpha chains by convertases formed by other complement fragments. They shar
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
672-748 aa
Secuencia
SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR
Número de adhesión
Peso molecular previsto
9.1 kDa
SDS-PAGE
10.9 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human Complement Component C3a Protein (rp183573) - SDS-PAGE
3 μg/lane of Recombinant Human Complement Component C3a Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.9 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Objetivos asociados (humanos)
C3 Tclin Complement C3 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1012990Certificate of AnalysisJun 15, 2026 rp183573
ZJ24F1012991Certificate of AnalysisJun 15, 2026 rp183573
ZJ24F1012992Certificate of AnalysisJun 15, 2026 rp183573
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Preguntas frecuentes

What is the purity of this product, and how is it determined?
This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.
What does Carrier Free mean?
Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.
What does PBS Only mean?
PBS Only is a defined analytical purity tier suitable for workflows requiring a specific validated property. It specifies a minimum assay percentage, controlled limits on common impurities (water, heavy metals, residue on ignition), and lot-to-lot consistency. PBS Only is one of several purity tiers — choose based on the sensitivity and regulatory requirements of your method.
How should this product be stored?
Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.
How is this product shipped?
This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.
What documentation is provided?
Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View PBS Only grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.