Recombinant Human COPS7A Protein

Cat. No.: rp192259
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥90%(SDS-PAGE) expressed in E. coli; See COA
Accession #
Q9UBW8
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp192259-10μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
89,90US$
50μg
rp192259-50μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
269,90US$
100μg
rp192259-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
429,90US$
1mg
rp192259-1mg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
2.599,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His Tag,≥90%(SDS-PAGE),expressed in E. coli; See COA Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human COPS7A Protein
Sinónimos
COP9 Signalosome Subunit 7A | COPS7A | Dermal Papilla-Derived Protein 10 | CSN7A | SGN7a | JAB1-Containing Signalosome Subunit 7a | COP9 Complex Subunit 7a | COP9 Constitutive Photomorphogenic Homolog Subunit 7A | COP9 Signalosome Complex Subunit 7a | DER
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His Tag, ≥90%(SDS-PAGE), expressed in E. coli; See COA
Mecanismos bioquímicos y fisiológicos
COP9 Signalosome Subunit 7A (COPS7A) is a component of the COP9 signalosome complex (CSN), a complex involved in a variety of cellular and developmental processes. The CSN complex is a vital regulator of the ubiquitin (Ubl) conjugation pathway by mediatin
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
2-275 aa
Secuencia
MHHHHHHSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Número de adhesión
Peso molecular previsto
31.1 kDa
SDS-PAGE
29.0 kDa, under reducing conditions; 29.0 & 63.6 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
expressed in E. coli; See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 6 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes
Recombinant Human COPS7A Protein (rp192259) - SDS-PAGE 
3 μg/lane of Recombinant Human COPS7A Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.0 kDa under reducing conditions and 29.0 & 63.6 kDa under non-reducing conditions. COPS7A contains a typical coiled-coil structure, formed by repeating heptad sequences (e.g., positions a–g), where the a and d positions are predominantly occupied by hydrophobic residues (such as leucine or isoleucine). These residues mediate hydrophobic interactions to stabilize the interface between helices. This structural motif exhibits a spontaneous tendency to form either homodimers or heterodimers (Uniprot:Q9UBW8).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.