Recombinant Human COX IV Protein, >90% (SDS-PAGE)

Cat. No.: rp176694
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. MBP tag ? MBP tag grade — recombinant protein bearing a MBP tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. MBP also improves solubility. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
P13073
Protein Tag
N-His & MBP
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human COX IV Protein (rp176694) at 1.0 μg/mL can bind COX IV Mouse mAb (Ab181868) with the EC50 of 74.4 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp176694-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
139,90US$
100μg
rp176694-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
599,90US$
1mg
rp176694-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,His Tag,MBP tag,≥90%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,His Tag,MBP tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Specifications

Product Name
Recombinant Human COX IV Protein, >90% (SDS-PAGE)
Sinónimos
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | Cytochrome c oxidase subunit 4 isoform 1 mitochondrial | Cytochrome C Oxidase subunit IV | Cytochrome c oxidase polypeptide IV | Cytochrome c oxidase subunit IV isoform 1 (COX IV-1) | Cytochrome c
Grado
ActiBioPure™, Bioactive, Carrier Free, His Tag, MBP tag
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, His Tag, MBP tag, ≥90%(SDS-PAGE)
Pureza
>90% (SDS-PAGE)
Bioactividad
Immobilized Recombinant Human COX IV Protein (rp176694) at 1.0 μg/mL can bind COX IV Mouse mAb (Ab181868) with the EC50 of 74.4 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
1-98 aa
Secuencia
MGSSHHHHHHGSSMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGIEENLYFQSMLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSN
Etiqueta proteínica
N-His & MBP
Número de adhesión
Peso molecular previsto
55.7 kDa
SDS-PAGE
56.5 kDa, under reducing conditions; 56.5 & 125.2 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Liquid
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.
Imágenes
Recombinant Human COX IV protein (rp176694) - ELISA 
Immobilized Recombinant Human COX IV Protein (rp176694) at 1.0 μg/mL can bind COX IV Mouse mAb (Ab181868) with the EC₅₀ of 74.4 ng/mL.
Recombinant Human COX IV protein (rp176694) - SDS-PAGE 
2 μg/lane of Recombinant Human COX IV protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 56.5 kDa under reducing conditions and 56.5 & 125.2 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.