Recombinant Human COX2 Protein, >90% (SDS-PAGE)

Cat. No.: rp176701

GRADE & PURITY Carrier Free, Azide Free, His Tag, ≥90%(SDS-PAGE)

Expression System

E. coli

Accession #

P00403

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Descripción general

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Specifications

Product Name

Recombinant Human COX2 Protein, >90% (SDS-PAGE)

Sinónimos

Cytochrome c oxidase polypeptide II | Cytochrome c oxidase subunit 2 | MT-CO2 | MT-CO2 | COII | COX2 | COXII | MTCO2

Grado

Azide Free, Carrier Free, His Tag

Especificaciones y pureza

Carrier Free, Azide Free, His-Tag, ≥90%(SDS-PAGE)

Pureza

>90% (SDS-PAGE)

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

90-227aa

Secuencia

MHHHHHHVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL

Etiqueta proteínica

N-His

Número de adhesión

P00403

Peso molecular previsto

16.5 kDa

SDS-PAGE

13.2 kDa, under reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human COX2 Protein

Recombinant Human COX2 Protein (rp176701) - SDS-PAGE
3 μg/lane of Recombinant Human COX2 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 13.2 kDa under reducing conditions.