Recombinant Human CXCL10/IP-10 Protein

Cat. No.: rp170434
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE)
Expression System
E. coli
Accession #
P02778
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human CXCL10/IP-10 Protein (rp170434) at 1.0 μg/mL can bind Eldelumab (anti-CXCL10) (Ab170882) with the EC50 of 268.7 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170434-10μg
≥10
139,90US$
50μg
rp170434-50μg
1
399,90US$
100μg
rp170434-100μg
1
639,90US$
1mg
rp170434-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥90%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Protein Function:
(C-X-C motif) ligand (CXCL)10 (CXCL10) belongs to the ELR(-) CXC subfamily chemokine. CXCL10/IP-10 exerts its function through binding to chemokine (C-X-C motif) receptor 3 (CXCR3), a seven trans-membrane receptor coupled to G proteins. CXCL10/IP-10 and its receptor, CXCR3, appear to contribute to the pathogenesis of many autoimmune diseases, organ specific (such as type 1 diabetes, autoimmune thyroiditis, Graves' disease and ophthalmopathy), or systemic (such as rheumatoid arthritis, psoriatic arthritis, systemic lupus erythematosus, mixed cryoglobulinemia, Sjögren syndrome, or systemic sclerosis). CXCL10/IP-10 is secreted by several cell types including endothelial cells, fibroblasts, keratinocytes, thyrocytes, preadipocytes, etc. Determination of high level of CXCL10/IP-10 in peripheral fluids is therefore a marker of host immune response.

Specifications

Product Name
Recombinant Human CXCL10/IP-10 Protein
Sinónimos
chemokine (C-X-C motif) ligand 10 | CRG2 | CRG-2 | CXCL10 | gIP-10 | IFI10 | INP10 | IP-10 | mob-1 | SCYB10 | C7
Grado
ActiBioPure™, Bioactive, Carrier Free, PBS Only
Especificaciones y pureza
Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥90%(SDS-PAGE)
Bioactividad
Immobilized Recombinant Human CXCL10/IP-10 Protein (rp170434) at 1.0 μg/mL can bind Eldelumab (anti-CXCL10) (Ab170882) with the EC50 of 268.7 ng/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
22-98 aa
Secuencia
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
20.8 kDa
SDS-PAGE
11.3 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human CXCL10/IP-10 Protein (rp170434) - ELISA
Immobilized Recombinant Human CXCL10/IP-10 Protein (rp170434) at 1.0 μg/mL can bind Eldelumab (anti-CXCL10) (Ab170882) with the EC₅₀of 268.7 ng/mL.


Recombinant Human CXCL10/IP-10 Protein (rp170434) - SDS-PAGE
1 μg/lane of Recombinant Human CXCL10/IP-10 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 11.3 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ26F0636007Certificate of AnalysisJun 05, 2026 rp170434
ZJ26F0636048Certificate of AnalysisJun 05, 2026 rp170434
ZJ26F0636047Certificate of AnalysisJun 05, 2026 rp170434
ZJ24F0708054Certificate of AnalysisFeb 24, 2026 rp170434
ZJ24F0708055Certificate of AnalysisFeb 24, 2026 rp170434
ZJ24F0708056Certificate of AnalysisFeb 24, 2026 rp170434
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.