Recombinant Human CXCL5 Protein, >97% (SDS-PAGE, HPLC)

Cat. No.: rp144864
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
P42830
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp144864-10μg
2
99,90US$
50μg
rp144864-50μg
1
339,90US$
100μg
rp144864-100μg
1
539,90US$
1mg
rp144864-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.199,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥97%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity

>97% SDS-PAGE or HPLC analyses. Endotoxin level is Less than 0.1EU/µg .


Function

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.


Post-translational

N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.


CXCL5 is a small cytokine also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). The protein is produced following stimulation of cells with the inflammatory cytokine interleukin-1 or tumor necrosis factor-alpha. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. They are produced by proteolytic cleavage after secretion from peripheral blood monocytes. Recombinant human CXCL5 (5-78 a.a.) contains 74 amino acids and it is a single non-glycosylated polypeptide chain. Human CXCL5 shares 57% amino acid sequence identity with mouse and rat CXCL5. Recombinant Human ENA-78/CXCL5 is an 8.1kDa protein containing 74 amino acid residues.


 

Specifications

Product Name
Recombinant Human CXCL5 Protein, >97% (SDS-PAGE, HPLC)
Sinónimos
chemokine (C-C motif) ligand 5 | C-X-C motif chemokine 5 | CXCL5 | CXCL5/ENA-78 | ENA78 | ENA-78 | ENA-78(1-78) | Epithelial-derived neutrophil-activating protein 78 | Neutrophil-activating peptide ENA-78 | neutrophil-activating protein 78 | SCYB5ENA78 |
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥97%(SDS-PAGE&HPLC)
Pureza
>97% (SDS-PAGE, HPLC)
Bioactividad
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
E.coli
Especie
Human
Aminoácidos
41-114 aa
Secuencia
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Etiqueta proteínica
No tag
Número de adhesión
Peso molecular previsto
8.1 kDa
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles.
Imágenes

Recombinant Human CXCL5 Protein ( rp144864) - Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/mL.

Recombinant Human CXCL5 Protein ( rp144864) - SDS-PAGE
2.5 μg/lane of Recombinant Human CXCL5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.4 kDa under reducing conditions and 12.0 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F0901074Certificate of AnalysisMar 20, 2026 rp144864
ZJ23F0901072Certificate of AnalysisFeb 10, 2026 rp144864
ZJ23F0901073Certificate of AnalysisFeb 10, 2026 rp144864
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.