Proteína cistatina A humana recombinante

Cat. No.: rp183667
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01040
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp183667-10μg
7
119,90US$
50μg
rp183667-50μg
4
339,90US$
100μg
rp183667-100μg
4
559,90US$
1mg
rp183667-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Sin portador, ≥95%(SDS-PAGE) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Conservar a -20°C,Evitar la congelación y descongelación repetidas Ships Hielera + almohadillas de hielo Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Función de la Proteína::
La cistatina-A, también conocida como cistatina-AS, Stefin-A y CSTA, es una proteína del citoplasma que pertenece a la familia de las cistatinas. La cistatina-A / CSTA es un inhibidor de la cisteína proteinasa con una masa molecular de 11 kDa, y se localiza principalmente en los gránulos queratohialinos del estrato granuloso y la envoltura cornificada del estrato córneo en la epidermis. Las cistatinas son una familia de inhibidores de proteasas de cisteína con homología a la cistatina de pollo. Las cistatinas son inhibidores fisiológicos de las cisteína proteinasas que están ampliamente distribuidas en los tejidos y fluidos humanos. Las cistatinas suelen tener unos 115 aminoácidos, son en gran parte ácidas y contienen cuatro residuos de cisteína conservados que forman dos enlaces disulfuro. Las cistatinas pueden estar glicosiladas y/o fosforiladas, con similitudes con las fetuinas, los cininógenos, las estefinas, las glicoproteínas ricas en histidina y las proteínas relacionadas con las cistatinas. Algunos de sus miembros son inhibidores activos de la cisteína proteasa, mientras que otros han perdido o quizá nunca han adquirido actividad inhibidora. Las cistatinas inhiben principalmente peptidasas pertenecientes a las familias de peptidasas C1 (familia de la papaína) y C13 (familia de la leguminosa).

Specifications

Product Name
Proteína cistatina A humana recombinante
Sinónimos
CSTA | cistatina A (estefina A) | cistatina A | cistatina AS | cistatina-A | estefina A | STF1 | STF1Cistatina-AS | STFA | STFAStefina-A | AREI
Grado
Carrier Free, His Tag
Especificaciones y pureza
Sin portador, ≥95%(SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
2-98 aa
Secuencia
MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
11.8 kDa
SDS-PAGE
12.2 kDa, under reducing conditions; 12.2 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Conservar a -20°C,Evitar la congelación y descongelación repetidas
Enviado en
Hielera + almohadillas de hielo
Estabilidad y almacenamiento
Conservar a -20°C durante 1 año. Evitar el ciclo de congelación/descongelación.
Imágenes

Recombinant Human Cystatin A Protein (rp183667) - SDS-PAGE
3 μg/lane of Recombinant Human Cystatin A Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 12.2 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0708301Certificate of AnalysisFeb 11, 2026 rp183667
ZJ24F0708302Certificate of AnalysisFeb 11, 2026 rp183667
ZJ24F0708303Certificate of AnalysisFeb 11, 2026 rp183667
ZJ24R0700773Certificate of AnalysisJul 06, 2024 rp183667
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.