Recombinant Human Cystatin C Protein

Cat. No.: rp169603
Disponible para pedir
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P01034
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Testing in progress
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp169603-10μg
≥10
219,90US$
50μg
rp169603-50μg
10
519,90US$
100μg
rp169603-100μg
10
759,90US$
1mg
rp169603-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.999,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,His-Tag,≥95%(SDS-PAGE) Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Cystatin C, also known as Cystatin-3 (CST3) is a secreted type 2 cysteine protease inhibitor synthesized in all nucleated cells, has been proposed as a replacement for serum creatinine for the assessment of renal function, particularly to detect small reductions in glomerular filtration rate. The mature, active form of human cystatin C is a single non-glycosylated polypeptide chain consisting of 120 amino acid residues, with a molecular mass of 13,343-13,359 Da, and containing four characteristic disulfide-paired cysteine residues. Cystatin C is a low-molecular-weight protein that has been proposed as a marker of renal function that could replace creatinine. Indeed, the concentration of Cystatin C is mainly determined by glomerular filtration and is particularly of interest in clinical settings where the relationship between creatinine production and muscle mass impairs the clinical performance of creatinine. Since the last decade, numerous studies have evaluated its potential use in measuring renal function in various populations. More recently, other potential developments for its clinical use have emerged. In almost all the clinical studies, Cystatin C demonstrated a better diagnostic accuracy than serum creatinine in discriminating normal from impaired kidney function, but controversial results have been obtained by comparing this protein with other indices of kidney disease, especially serum creatinine-based equations, such as early atherosclerosis, Alzheimer's dementia, vascular aneurysms, hyperhomocysteinaemia and other neurodegenerative diseases. Cystatin C could be a useful clinical tool to identify HIV-infected persons. In addition, its expression is up-regulated in malignance of certain tumor progression.

Specifications

Product Name
Recombinant Human Cystatin C Protein
Sinónimos
AD 8 | AD8 | Amyloid angiopathy and cerebral hemorrhage | ARMD11 | bA218C14.4 | bA218C14.4 (cystatin C) | Cst 3 | Cst3 | CST3 protein | Cystatin 3 | Cystatin-3 | Cystatin-C | Cystatin3 | CystatinC | CYTC_HUMAN | Epididymis secretory protein Li 2 | Gamma t
Grado
Carrier Free, His Tag
Especificaciones y pureza
Carrier Free, His-Tag, ≥95%(SDS-PAGE)
Bioactividad
Testing in progress
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Aminoácidos
27-146 aa
Secuencia
MGSSHHHHHHSSGLVPRGSMGSSHHHHHHSSGLVPRGSSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
17.4 kDa
SDS-PAGE
17.1 kDa, under reducing conditions; 17.1 kDa, under non-reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Liquid
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Imágenes

Recombinant Human Cystatin C Protein (rp169603) - SDS-PAGE
2 μg/lane of Recombinant Human Cystatin C Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.1 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0506345Certificate of AnalysisMay 31, 2024 rp169603
ZJ24F0506341Certificate of AnalysisMay 31, 2024 rp169603
ZJ24F0506340Certificate of AnalysisMay 31, 2024 rp169603
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Need help choosing the grade?

Our grade selection guide covers purity, stabilizer status, and application suitability for all variants in our catalog.

View Carrier Free grade guide → View His Tag grade guide →

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.