Recombinant Human DC-SIGN/CD209 Protein, ≥95% (SDS-PAGE)

Cat. No.: rp145038
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9NNX6
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of ICAM-3 expressing CHO Chinese hamster ovary cells. When 5 x 10^4 cells/well are added to Recombinant Human DC_x001e_SIGN/CD209 Protein coated plates (5 μg/mL with 100 μL/well), approximately 10-20% of added cells will adhere after 1 hour at 37℃.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp145038-10μg
7
139,90US$
50μg
rp145038-50μg
2
409,90US$
100μg
rp145038-100μg
1
589,90US$
1mg
rp145038-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
4.949,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, cytomegalovirus gB, HCV E2, dengue virus gE, Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA. On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells.

Specifications

Product Name
Recombinant Human DC-SIGN/CD209 Protein, ≥95% (SDS-PAGE)
Sinónimos
C-type lectin domain family 4 member L | DC-SIGN | DC-SIGN1 | Dendritic cell-specific ICAM-3-grabbing non-integrin 1 | C type lectin domain family 4 member L | C-type lectin domain family 4 member L | CD 209 | CD209 | CD209 antigen | CD209 antigen-like pr
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Pureza
≥95% (SDS-PAGE)
Bioactividad
Measured by the ability of the immobilized protein to support the adhesion of ICAM-3 expressing CHO Chinese hamster ovary cells. When 5 x 10^4 cells/well are added to Recombinant Human DC_x001e_SIGN/CD209 Protein coated plates (5 μg/mL with 100 μL/well), approximately 10-20% of added cells will adhere after 1 hour at 37℃.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
59-404 aa
Secuencia
QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPAHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
40 kDa
SDS-PAGE
40 - 50 kDa, under reducing conditions; 38 - 48 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human DC-SIGN/CD209 Protein (rp145038) - SDS-PAGE
3 μg/lane of Recombinant Human DC-SIGN/CD209 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a  band at 40 - 50 kDa under reducing conditions and 38 - 48 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1215562Certificate of AnalysisJul 10, 2026 rp145038
ZJ24F1215563Certificate of AnalysisJul 10, 2026 rp145038
ZJ24F1215564Certificate of AnalysisJul 10, 2026 rp145038
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.