Recombinant Human DC-SIGNR/CD299 Protein

Cat. No.: rp145040
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥90%(SDS-PAGE)
Expression System
HEK293
Accession #
Q9H2X3-8
Protein Tag
N-hFc
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of ICAM-3 expressing CHO Chinese hamster ovary cells. When 5 x 10^4 cells/well are added to rhDC-SIGNR/Fc Chimera coated plates (5 µg/mL with 100 µL/well), approximately 40%-70% of added cells will adhere after 1 hour at room temperature.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp145040-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
131,90US$
50μg
rp145040-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
395,90US$
100μg
rp145040-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
665,90US$
1mg
rp145040-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.945,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,Fc tag,≥90%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,Fc tag,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Function
Probable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, HCV E2, and human SARS coronavirus protein S. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates. Is presumably a coreceptor for the SARS coronavirus.

Specifications

Product Name
Recombinant Human DC-SIGNR/CD299 Protein
Sinónimos
CD209 antigen-like protein 1 | DC-SIGN2 | DC-SIGNR | DC-SIGN-related protein | Dendritic cell-specific ICAM-3-grabbing non-integrin 2 | Liver/lymph node-specific ICAM-3-grabbing non-integrin | L-SIGN | CD209L | CD209L1 | CD209Ldendritic cell-specific ICAM
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, Fc tag, High Performance
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, Fc tag, ≥90%(SDS-PAGE)
Bioactividad
Measured by the ability of the immobilized protein to support the adhesion of ICAM-3 expressing CHO Chinese hamster ovary cells. When 5 x 10^4 cells/well are added to rhDC-SIGNR/Fc Chimera coated plates (5 µg/mL with 100 µL/well), approximately 40%-70% of added cells will adhere after 1 hour at room temperature.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
73-376 aa
Secuencia
MDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Etiqueta proteínica
N-hFc
Número de adhesión
Peso molecular previsto
61.4 kDa
SDS-PAGE
61-66 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human DC-SIGNR/CD299 Protein (rp145040) - SDS-PAGE
2 μg/lane of Recombinant Human DC-SIGNR/CD299 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 62 kDa under reducing conditions and 125 & 250 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeFechaArticulo
ZJ25F0521739Certificate of AnalysisMar 16, 2026 rp145040
ZJ25F0521740Certificate of AnalysisMar 16, 2026 rp145040
ZJ25F0521741Certificate of AnalysisMar 16, 2026 rp145040
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.