Recombinant Human E-selectin/CD62E Protein

Cat. No.: rp217606
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥90%(SDS-PAGE) See COA
Accession #
P16581
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to human E-Selectin/Fc Chimera coated plates (1 µg/mL with 100 µL/well), approximately 90-100% will adhere after 2 hour incubation at RT.
Size
Estado
Price
Qty
10μg
rp217606-10μg
5
69,90US$
50μg
rp217606-50μg
5
199,90US$
100μg
rp217606-100μg
5
299,90US$
1mg
rp217606-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.089,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥90%(SDS-PAGE),See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human E-selectin/CD62E Protein
Sinónimos
CD62 antigen-like family member E | CD62E antigen | CD62E | ELAM | ELAM1 | ELAM-1 | ELAM1E-selectin | endothelial adhesion molecule 1 | Endothelial leukocyte adhesion molecule 1 | ESEL | E-Selectin | LECAM2 | leukocyte endothelial cell adhesion molecule 2
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥90%(SDS-PAGE), See COA
Mecanismos bioquímicos y fisiológicos
E-Selectin (Endothelial Leukocyte Adhesion Molecule-1, ELAM-1, CD62E), a member of the Selectin family, is a 107 - 115 kDa cell surface glycoprotein. It is transiently expressed on vascular endothelial cells in response to IL-1 beta and TNF-alpha, and dem
Bioactividad
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to human E-Selectin/Fc Chimera coated plates (1 µg/mL with 100 µL/well), approximately 90-100% will adhere after 2 hour incubation at RT.
Concentración de endotoxinas
<1.0 EU/μg
Aminoácidos
1-230 aa
Secuencia
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWHHHHHH
Número de adhesión
Peso molecular previsto
24.5 kDa
SDS-PAGE
33.0-40.0 kDa, under reducing conditions; 30.5-37.3 & 54.5-63.7 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Concentración
See COA
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human E-selectin/CD62E Protein (rp217606) - Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to human E-Selectin/Fc Chimera coated plates (1 µg/mL with 100 µL/well), approximately 90-100% will adhere after 2 hour incubation at RT.

Recombinant Human E-selectin/CD62E Protein (rp217606) - SDS-PAGE
3 μg/lane of Recombinant Human E-selectin/CD62E Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 33.0-40.0 kDa under reducing conditions and 30.5-37.3 & 54.5-63.7 kDa under non-reducing conditions.
Under specific non-physiological conditions, including high concentrations or particular buffer environments, CD62E (E-selectin) may coexist as both monomers and dimers (Uniprot ID: P16581).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.