Recombinant Human EGF GMP Protein

Cat. No.: rp168403-GMP
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&SEC-HPLC)
Expression System
E. coli
Accession #
P01133-1
Protein Tag
No tag/C-His tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 20‑100 pg/mL. The specific activity of Recombinant Human EGF is >8.0 x 10^5 IU/mg, which is calibrated against the human EGF WHO International Standard (NIBSC code: 91/530).
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
200μg
rp168403-GMP-200μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
693,90US$
1mg
rp168403-GMP-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
1.889,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥97%(SDS-PAGE&SEC-HPLC) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human EGF GMP Protein
Sinónimos
Epidermal Growth Factor | beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag, PBS Only
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, His Tag, PBS Only, ≥97%(SDS-PAGE&SEC-HPLC)
Mecanismos bioquímicos y fisiológicos
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR
Bioactividad
Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 20‑100 pg/mL. The specific activity of Recombinant Human EGF is >8.0 x 10^5 IU/mg, which is calibrated against the human EGF WHO International Standard (NIBSC code: 91/530).
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
E. coli
Aminoácidos
971-1023 aa
Secuencia
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Etiqueta proteínica
No tag/C-His tag
Secuencia N-terminal
Met-Asn971-Ser-Asp-Ser-Glu-(Cys)-Pro-Leu-Ser
Número de adhesión
Peso molecular previsto
6 kDa
SDS-PAGE
6 kDa under reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
Reconstitute at 200 μg/mL in PBS.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.