Proteína humana recombinante EpCAM/TROP1

Cat. No.: rp170132
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P16422
Protein Tag
C-His
Expression system
HEK293
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.068 μg/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp170132-10μg
7
107,90US$
50μg
rp170132-50μg
4
319,90US$
100μg
rp170132-100μg
4
479,90US$
1mg
rp170132-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
2.873,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactivo, Sin animales, Sin portador, Alto rendimiento, ≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Conservar a -20°C,Evitar la congelación y descongelación repetidas Ships Hielera + almohadillas de hielo Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

La molécula de adhesión celular epitelial (EpCAM), también conocida como antígeno GA733-2, es una glicoproteína transmembrana de tipo I compuesta por un dominio extracelular con dos repeticiones EGF-Like y una región rica en cistina, un dominio transmembrana y un dominio citoplasmático. Modula la adhesión y la proliferación celular. Su sobreexpresión se ha detectado en muchos tumores epiteliales y se ha asociado con un estadio elevado, un grado alto y una peor supervivencia en algunos tipos de tumores. Se ha demostrado que EpCAM funciona como una molécula de adhesión celular homófila independiente del calcio que no presenta ninguna relación evidente con las cuatro superfamilias de moléculas de adhesión celular conocidas. Sin embargo, estudios recientes han revelado que EpCAM participa no sólo en la adhesión celular, sino también en la proliferación, migración y diferenciación de las células. Además, estudios recientes han revelado que EpCAM es el gen diana de la señalización Wnt-beta-catenina y puede utilizarse para facilitar el pronóstico. Tiene potencial oncogénico y se activa mediante la liberación de su dominio intracelular, que puede señalar hacia el núcleo celular mediante el compromiso de elementos de la vía wnt.

Specifications

Product Name
Proteína humana recombinante EpCAM/TROP1
Sinónimos
323/A3 | ACSTD1 | antígeno identificado por monoclonal AUA1 | antígeno CD326 | glicoproteína de superficie celular Trop-1 | cromosoma 4, marcador de superficie (glicoproteína de 35kD) | DIAR5 | 17-1A | EGP | EGP-2 | EGP314 | EGP40 | EpCAM | molécula de ad
Grado
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, His Tag
Especificaciones y pureza
ActiBioPure™, Bioactivo, Sin animales, Sin portador, Alto rendimiento, ≥95%(SDS-PAGE)
Bioactividad
Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.068 μg/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
HEK293
Aminoácidos
1-265 aa
Secuencia
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKHHHHHH
Etiqueta proteínica
C-His
Número de adhesión
Peso molecular previsto
28.2 kDa
SDS-PAGE
32.0-42.0 kDa, under reducing conditions
Tipo de molécula
Protein
Almacenamiento y envío
Reconstitución
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Condiciones de almacenamiento de almacenamiento
Conservar a -20°C,Evitar la congelación y descongelación repetidas
Enviado en
Hielera + almohadillas de hielo
Estabilidad y almacenamiento
Conservar a -20°C durante 1 año. Evitar el ciclo de congelación/descongelación.
Imágenes

Recombinant Human EpCAM/TROP1 Protein (rp170132) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.068 μg/mL.

Recombinant Human EpCAM/TROP1 Protein (rp170132) - SDS-PAGE
3 μg/lane of Recombinant Human EpCAM/TROP1 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 32.0-42.0 kDa under reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F0708473Certificate of AnalysisFeb 11, 2026 rp170132
ZJ24F0708474Certificate of AnalysisFeb 11, 2026 rp170132
ZJ24F0708475Certificate of AnalysisFeb 11, 2026 rp170132
ZJ24R0700782Certificate of AnalysisJul 12, 2024 rp170132
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.