Recombinant Human Ephrin-A4 Protein, ≥95% (SDS-PAGE)

Cat. No.: rp145636
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. Fc tag ? Fc tag grade — recombinant protein bearing a Fc tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. The Fc tag aids dimerization and protein-A/G capture. ≥95%(SDS-PAGE)
Expression System
HEK293
Accession #
P52798-1
Protein Tag
C-hFc & His
Expression system
HEK293
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
1. Immobilized Human EphA7 at 0.5 μg/mL (100 μL/well) can bind Human EFNA4 with a linear range of 0.039-0.942 ng/mL. 2. Immobilized Recombinant Human EphA2 Protein (rp181601) at 2.0 μg/mL can bind Recombinant Human Ephrin-A4 Protein (rp145636) with the EC50 of 7.41 ng/mL. 3. Immobilized Recombinant Human EphA4 Protein (rp183616) at 2.0 μg/mL can bind Human Recombinant Ephrin-A4 Protein (rp145636) with the EC50 of 8.85 ng/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
10μg
rp145636-10μg
7
119,90US$
50μg
rp145636-50μg
3
279,90US$
100μg
rp145636-100μg
1
439,90US$
1mg
rp145636-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.039,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,Fc tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,Fc tag,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.

Specifications

Product Name
Recombinant Human Ephrin-A4 Protein, ≥95% (SDS-PAGE)
Sinónimos
EPH-related receptor tyrosine kinase ligand 4 | LERK-4 | EFL 4 | EFL4 | EFN A4 | EFNA 4 | EFNA4 | EFNA4_HUMAN | Eph related receptor tyrosine kinase ligand 4 | EPH-related receptor tyrosine kinase ligand 4 | Ephrin-A4 | EphrinA4 | EPLG4 | EPLG 4 | LERK 4
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, Fc tag, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His-Tag, Fc tag, ≥95%(SDS-PAGE)
Pureza
≥95% (SDS-PAGE)
Bioactividad
1. Immobilized Human EphA7 at 0.5 μg/mL (100 μL/well) can bind Human EFNA4 with a linear range of 0.039-0.942 ng/mL. 2. Immobilized Recombinant Human EphA2 Protein (rp181601) at 2.0 μg/mL can bind Recombinant Human Ephrin-A4 Protein (rp145636) with the EC50 of 7.41 ng/mL. 3. Immobilized Recombinant Human EphA4 Protein (rp183616) at 2.0 μg/mL can bind Human Recombinant Ephrin-A4 Protein (rp145636) with the EC50 of 8.85 ng/mL.
Concentración de endotoxinas
<0.1 EU/μg
Sistema de expresión
HEK293
Especie
Human
Aminoácidos
26-171 aa
Secuencia
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Etiqueta proteínica
C-hFc & His
Número de adhesión
Peso molecular previsto
44 kDa
SDS-PAGE
50 kDa, under reducing conditions; 110 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Condiciones de almacenamiento de almacenamiento
Store at -20°C,Avoid repeated freezing and thawing
Enviado en
Ice chest + Ice pads
Estabilidad y almacenamiento
Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
Imágenes

Recombinant Human Ephrin-A4 Protein (rp145636) - Protein Bioactivity
Immobilized Recombinant Human EphA2 Protein (rp181601) at 2.0 μg/mL can bind Recombinant Human Ephrin-A4 Protein (rp145636) with the EC50 of 7.41 ng/mL.

Recombinant Human Ephrin-A4 Protein (rp145636) - Protein Bioactivity
Immobilized Recombinant Human EphA4 Protein (rp183616) at 2.0 μg/mL can bind Human Recombinant Ephrin-A4 Protein (rp145636) with the EC50 of 8.85 ng/mL.

Recombinant Human Ephrin-A4 Protein (rp145636) - SDS-PAGE
3 μg/lane of Recombinant Human Ephrin-A4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 50 kDa under reducing condition and 110 kDa under non-reducing condition.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeFechaArticulo
ZJ24F1215414Certificate of AnalysisJul 10, 2026 rp145636
ZJ24F1215415Certificate of AnalysisJul 10, 2026 rp145636
ZJ24F1215416Certificate of AnalysisJul 10, 2026 rp145636
ZJ24F0708606Certificate of AnalysisMar 13, 2026 rp145636
ZJ24F0708607Certificate of AnalysisMar 13, 2026 rp145636
ZJ24F0708608Certificate of AnalysisMar 13, 2026 rp145636
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.