Recombinant Human FGF-21 Protein, >95% (SDS-PAGE)

Cat. No.: rp169669

GRADE & PURITY Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

Q9NSA1

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Descripción general

Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Fibroblast growth factor 21 (FGF-21) is a member of the FGF gene family, which currently contains 22 human members. Based on its structure, it is further classified as an FGF19 subfamily member. This subfamily includes FGF-19, -21, and -23. Like all other FGF subfamilies, FGF-19 subfamily members contain a 120 amino acid (aa) core FGF domain that exhibits a beta -trefoil structure. Unlike other FGF subfamilies, FGF-19 subfamily members apparently exhibit poor binding to ECM, resulting in highly diffusible molecules. The c-DNA for FGF-21 predicts a 209 aa polypeptide that contains a 28 aa signal sequence and a 181 aa mature region. Notably, FGF-21, as well as FGF-19 show limited binding to heparin. One potential alternate splice form has been reported. It shows a 43 aa substitution for the C-terminal 12 aa of the standard form. Mature human FGF-21 shows 81% aa identity to mouse FGF-21, and is known to be active on mouse cells. The FGF-19 subfamily is considered endocrine in nature. All three subfamily members impact some aspect of metabolism, all three are induced by a nuclear receptor heterodimer that includes RXR, and all three utilize Klotho family members for signal transduction. FGF-21 is produced by hepatocytes in response to free fatty acid (FFA) stimulation of a PPARa/RXR dimeric complex. This situation occurs clinically during starvation, or following the ingestion of a high-fat/low-carbohydrate diet. Upon FGF-21 secretion, white adipose tissue is induced to release FFAs from triglyceride stores. Once FFAs reach hepatocytes, they are oxidized and reduced to acetyl-CoA. The acetyl-CoA is recombined into 4-carbon ketone bodies (acetoacetate and beta -hydroxybutyrate), released, and transported to peripheral tissues for TCA processing and energy generation.

Specifications

Product Name

Recombinant Human FGF-21 Protein, >95% (SDS-PAGE)

Sinónimos

FGF 21 | FGF-21 | Fgf21 | FGF21_HUMAN | FGFL | Fibroblast growth factor 21 | PRO10196 | UNQ3115

Grado

Azide Free, Carrier Free, His Tag, PBS Only

Especificaciones y pureza

Carrier Free, Azide Free, His Tag, PBS Only, ≥95%(SDS-PAGE)

Pureza

>95% (SDS-PAGE)

Bioactividad

Testing in progress

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

29-209 aa

Secuencia

MGSSHHHHHHSSGLVPRGSHMMHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Etiqueta proteínica

N-His

Número de adhesión

Q9NSA1

Peso molecular previsto

21.8 kDa

SDS-PAGE

26.2 kDa, under reducing conditions；25.3 kDa, under non-reducing condition

Tipo de molécula

Protein

Almacenamiento y envío

Forma

Lyophilized

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Imágenes

SDS-PAGE: Recombinant Human FGF-21 Protein (rp169669)

Recombinant Human FGF-21 Protein (rp169669) - SDS-PAGE
3 μg/lane of Recombinant Human FGF-21 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.2 kDa under reducing conditions and 25.3 kDa under non-reducing conditions.