Recombinant Human FGF acidic/FGF1 Protein

Cat. No.: rp170413

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P05230

Protein Tag

No tag

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED50 for this effect is typically 0.28 ng/mL.

Descripción general

Protein Function:
FGF acidic, also known as FGF1, ECGF, and HBGF-1, is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which is produced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. Human FGF acidic shares 54% amino acid sequence identity with FGF basic and 17%‑33% with other human FGFs. It shares 92%, 96%, 96%, and 96% aa sequence identity with bovine, mouse, porcine, and rat FGF acidic, respectively, and exhibits considerable species crossreactivity. Alternate splicing generates a truncated isoform of human FGF acidic that consists of the N-terminal 40% of the molecule and functions as a receptor antagonist. During its nonclassical secretion, FGF acidic associates with S100A13, copper ions, and the C2A domain of synaptotagmin 1. It is released extracellularly as a disulfide-linked homodimer and is stored in complex with extracellular heparan sulfate. The ability of heparan sulfate to bind FGF acidic is determined by its pattern of sulfation, and alterations in this pattern during embryogenesis thereby regulate FGF acidic bioactivity. The association of FGF acidic with heparan sulfate is a prerequisite for its subsequent interaction with FGF receptors. Ligation triggers receptor dimerization, transphosphorylation, and internalization of receptor/FGF complexes. Internalized FGF acidic can translocate to the cytosol with the assistance of Hsp90 and then migrate to the nucleus by means of its two nuclear localization signals. The phosphorylation of FGF acidic by nuclear PKC delta triggers its active export to the cytosol where it is dephosphorylated and degraded. Intracellular FGF acidic functions as a survival factor by inhibiting p53 activity and proapoptotic signaling.

Specifications

Product Name

Recombinant Human FGF acidic/FGF1 Protein

Sinónimos

AFGF | alpha | alpha-ECGF | beta-ECGF | ECGF | ECGFB | ECGF-betaAcidic fibroblast growth factor | endothelial cell growth factor, beta | FGF acidic | FGF-1 | FGFABeta-endothelial cell growth factor | FGF-alpha | fibroblast growth factor 1 (acidic) | GLIO7

Grado

ActiBioPure™, Bioactive, Carrier Free, High Performance

Especificaciones y pureza

ActiBioPure™, Bioactive, Carrier Free, High performance, ≥95%(SDS-PAGE)

Bioactividad

Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED50 for this effect is typically 0.28 ng/mL.

Concentración de endotoxinas

<1.0 EU/μg

Sistema de expresión

E. coli

Aminoácidos

16-155 aa

Secuencia

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Etiqueta proteínica

No tag

Número de adhesión

P05230

Peso molecular previsto

15.9 kDa

SDS-PAGE

14.3 kDa, under reducing conditions; 14.2 kDa, under non-reducing conditions

Tipo de molécula

Protein

Almacenamiento y envío

Reconstitución

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Condiciones de almacenamiento de almacenamiento

Store at -20°C,Avoid repeated freezing and thawing

Enviado en

Ice chest + Ice pads

Estabilidad y almacenamiento

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Imágenes

Protein Bioactivity: Recombinant Human FGF acidic/FGF1 Protein (rp170413)

Recombinant Human FGF acidic/FGF1 Protein (rp170413) - Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line in the presence of 10 µg/mL heparin sodium (H104201). The ED₅₀ for this effect is typically 0.28 ng/mL.

SDS-PAGE: Recombinant Human FGF acidic/FGF1 Protein (rp170413)

Recombinant Human FGF acidic/FGF1 Protein (rp170413) - SDS-PAGE
3 μg/lane of Recombinant Human FGF acidic/FGF1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.3 kDa under reducing conditions and 14.2 kDa under non-reducing conditions.