Recombinant Human FGF19 Protein, >98% SDS-PAGE

Cat. No.: rp145934
Disponible para pedir
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥98%(SDS-PAGE)
Expression System
E. coli
Accession #
O95750
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
FGF19 is a member of the fibroblast growth factor (FGF) family. FGFs are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. In general, FGFs are expressed during embryonic development and in restricted adult tissues. Human FGF-19 cDNA predicts a 251 aa precursor protein with a 22 aa signal peptide and a 229 aa secreted mature protein with no potential N-linked glycosylation sites. FGF19-FGFR1 is one of paired transcripts mediating the dialogues between extraembryonic membrane and endometrium. A functional binding ELISA assay was conducted to detect the interaction of Recombinant Human FGF19 Protein (rp145934) and recombinant human FGFR1, the EC50 for this effect is 0.16 μg/mL.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
25μg
rp145934-25μg
5
179,90US$
100μg
rp145934-100μg
3
569,90US$
1mg
rp145934-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
3.399,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥98%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -80°C,Avoid repeated freezing and thawing Ships Dry ice packs + Cold packs Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Descripción general

Purity

≥ 98% SDS-PAGE.


Function

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB.

Specifications

Product Name
Recombinant Human FGF19 Protein, >98% SDS-PAGE
Sinónimos
FGF19 | FGF-19 | fibroblast growth factor 19 | FGF 19 | FGF15 | FGF19_HUMAN | Fibroblast growth factor 15 | FGF-19
Grado
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, His Tag
Especificaciones y pureza
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, His-Tag, ≥98%(SDS-PAGE)
Pureza
>98% SDS-PAGE
Bioactividad
FGF19 is a member of the fibroblast growth factor (FGF) family. FGFs are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. In general, FGFs are expressed during embryonic development and in restricted adult tissues. Human FGF-19 cDNA predicts a 251 aa precursor protein with a 22 aa signal peptide and a 229 aa secreted mature protein with no potential N-linked glycosylation sites. FGF19-FGFR1 is one of paired transcripts mediating the dialogues between extraembryonic membrane and endometrium. A functional binding ELISA assay was conducted to detect the interaction of Recombinant Human FGF19 Protein (rp145934) and recombinant human FGFR1, the EC50 for this effect is 0.16 μg/mL.
Concentración de endotoxinas
<1.0 EU/μg
Sistema de expresión
E. coli
Especie
Human
Aminoácidos
4-216 aa
Secuencia
GCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Etiqueta proteínica
N-His
Número de adhesión
Peso molecular previsto
27.4 kDa
SDS-PAGE
27.7 kDa, under reducing conditions; 27.4 & 54.0 kDa, under non-reducing conditions.
Tipo de molécula
Protein
Almacenamiento y envío
Forma
Lyophilized
Reconstitución
Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0mg/mL. Do not vortex.
Condiciones de almacenamiento de almacenamiento
Store at -80°C,Avoid repeated freezing and thawing
Enviado en
Dry ice packs + Cold packs
Estabilidad y almacenamiento
Avoid repeated freeze/thaw cycles. Store at 2-8℃ for one month. Aliquot and store at -80℃ for 12 month.
Imágenes

Recombinant Human FGF19 Protein (rp145934) - Protein Bioactivity
FGF19 is a member of the fibroblast growth factor (FGF) family. FGFs are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. In general, FGFs are expressed during embryonic development and in restricted adult tissues. Human FGF-19 cDNA predicts a 251 aa precursor protein with a 22 aa signal peptide and a 229 aa secreted mature protein with no potential N-linked glycosylation sites. FGF19-FGFR1 is one of paired transcripts mediating the dialogues between extraembryonic membrane and endometrium. A functional binding ELISA assay was conducted to detect the interaction of Recombinant Human FGF19 Protein (rp145934) and recombinant human FGFR1, the EC₅₀ for this effect is 0.16 μg/mL.

Recombinant Human FGF19 Protein (rp145934) - SDS-PAGE
3 μg/lane of Recombinant Human FGF19 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 27.7 kDa under reducing conditions and 27.4 & 54.0 kDa under non-reducing conditions.

Recombinant Human FGF19 Protein (rp145934) - Binding Activity
Immobilized Recombinant Human FGF19 Protein (rp145934) at 2.0 μg/mL can bind Recombinant Mouse Klotho beta Protein (rp184968) with the EC50 of 153.2 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeFechaArticulo
ZJ23F1101865Certificate of AnalysisApr 10, 2026 rp145934
ZJ23F1101866Certificate of AnalysisApr 10, 2026 rp145934
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.