Recombinant Human FGF8 Protein, ≥95% (SDS-PAGE)
Disponible
SKU
rp145972
Animal Free, ≥95% (SDS-PAGE), Active, E.coli, No tag, 23-204 aa
Más Información
| Sinónimos | AIGF | AIGFKAL6 | Androgen-induced growth factor | FGF8 | FGF-8 | Fibroblast growth factor 8 (androgen-induced) | Fibroblast growth factor 8 | HBGF-8 | Heparin-binding growth factor 8 | MGC149376 | HH6 | KAL6 | AIGF | Androgen-induced growth factor | FGF- |
|---|---|
| Product Description | |
| Especificaciones y pureza | Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, ≥95%(SDS-PAGE) |
| Pureza | ≥95% (SDS-PAGE) |
| Bioactividad | Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED50 for this effect is typically 0.8-3.3 μg/mL. |
| Concentración de endotoxinas | <1.0 EU/μg |
| Sistema de expresión | E.coli |
| Especie | Human |
| Aminoácidos | 23-204 aa |
| Secuencia | MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVL ENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR |
| Etiqueta proteínica | No tag |
| Número de adhesión | P55075-2 |
| SDS-PAGE | 21.5 kDa, under reducing conditions; 21.5 kDa, under non-reducing conditions. |
| Forma | Lyophilized |
| Reconstitución | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL. |
| Condiciones de almacenamiento de almacenamiento | Store at -20°C,Avoid repeated freezing and thawing |
| Enviado en | Ice chest + Ice pads |
| Estabilidad y almacenamiento | Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Identificación genética | 2253 |
| Símbolo genético | FGF8 |
Reseñas
Reseñas de cliente
Remind me later